Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | UXR08_RS08065 | Genome accession | NZ_CP154497 |
| Coordinates | 1658772..1659083 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BSN57 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1653772..1664083
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR08_RS08030 (UXR08_08030) | gcvPA | 1654274..1655620 (-) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| UXR08_RS08035 (UXR08_08035) | gcvT | 1655640..1656731 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| UXR08_RS08040 (UXR08_08040) | - | 1656890..1657414 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| UXR08_RS08045 (UXR08_08045) | - | 1657404..1657550 (-) | 147 | WP_001792109.1 | hypothetical protein | - |
| UXR08_RS08050 (UXR08_08050) | comGF | 1657647..1658144 (-) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| UXR08_RS08055 (UXR08_08055) | comGE | 1658062..1658361 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| UXR08_RS08060 (UXR08_08060) | comGD | 1658348..1658794 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| UXR08_RS08065 (UXR08_08065) | comGC | 1658772..1659083 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| UXR08_RS08070 (UXR08_08070) | comGB | 1659097..1660167 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| UXR08_RS08075 (UXR08_08075) | comGA | 1660139..1661113 (-) | 975 | WP_000697221.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| UXR08_RS08080 (UXR08_08080) | - | 1661165..1661788 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| UXR08_RS08085 (UXR08_08085) | - | 1661785..1662114 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| UXR08_RS08090 (UXR08_08090) | - | 1662114..1663100 (-) | 987 | WP_000161311.1 | ROK family glucokinase | - |
| UXR08_RS08095 (UXR08_08095) | - | 1663097..1663300 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=993612 UXR08_RS08065 WP_000472256.1 1658772..1659083(-) (comGC) [Staphylococcus aureus strain BSN57]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=993612 UXR08_RS08065 WP_000472256.1 1658772..1659083(-) (comGC) [Staphylococcus aureus strain BSN57]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |