Detailed information NTG0993126

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: E0E08_RS08405
• Genome accession: NZ_LR027873
• Coordinates: 1660958..1661269 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: A0A0H2XGS7
• Organism: Staphylococcus aureus strain BPH2070 isolate BPH2070
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1655958..1666269

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
E0E08_RS08370	gcvPA	1656460..1657806 (-)	1347	WP_000019684.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
E0E08_RS08375	gcvT	1657826..1658917 (-)	1092	WP_000093351.1	glycine cleavage system aminomethyltransferase GcvT	-
E0E08_RS08380	-	1659076..1659600 (-)	525	WP_001015117.1	shikimate kinase	-
E0E08_RS08385	-	1659590..1659736 (-)	147	WP_001789879.1	hypothetical protein	-
E0E08_RS08390	comGF	1659833..1660330 (-)	498	WP_001803317.1	competence type IV pilus minor pilin ComGF	Machinery gene
E0E08_RS08395	comGE	1660248..1660547 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
E0E08_RS08400	comGD	1660534..1660980 (-)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
E0E08_RS08405	comGC	1660958..1661269 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
E0E08_RS08410	comGB	1661283..1661588 (-)	306	WP_332005405.1	type II secretion system F family protein	Machinery gene
E0E08_RS08415	-	1661574..1662746 (+)	1173	WP_000195429.1	IS256-like element IS256 family transposase	-
E0E08_RS08420	-	1662798..1663406 (-)	609	Protein_1582	type II secretion system F family protein	-
E0E08_RS08425	comGA	1663378..1664352 (-)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
E0E08_RS08430	-	1664404..1665027 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
E0E08_RS08435	-	1665024..1665353 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=993126 E0E08_RS08405 WP_000472256.1 1660958..1661269(-) (comGC) [Staphylococcus aureus strain BPH2070 isolate BPH2070]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=993126 E0E08_RS08405 WP_000472256.1 1660958..1661269(-) (comGC) [Staphylococcus aureus strain BPH2070 isolate BPH2070]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A0H2XGS7

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comGC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369