Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | ACOCJJ_RS07655 | Genome accession | NZ_CP184561 |
| Coordinates | 1593704..1594015 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain CBTW2018311 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1588704..1599015
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACOCJJ_RS07620 (ACOCJJ_07620) | gcvPA | 1589206..1590552 (-) | 1347 | WP_000019698.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| ACOCJJ_RS07625 (ACOCJJ_07625) | gcvT | 1590572..1591663 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACOCJJ_RS07630 (ACOCJJ_07630) | - | 1591822..1592346 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| ACOCJJ_RS07635 (ACOCJJ_07635) | - | 1592336..1592482 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| ACOCJJ_RS07640 (ACOCJJ_07640) | comGF | 1592579..1593076 (-) | 498 | WP_001825340.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ACOCJJ_RS07645 (ACOCJJ_07645) | comGE | 1592994..1593293 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| ACOCJJ_RS07650 (ACOCJJ_07650) | comGD | 1593280..1593726 (-) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACOCJJ_RS07655 (ACOCJJ_07655) | comGC | 1593704..1594015 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACOCJJ_RS07660 (ACOCJJ_07660) | comGB | 1594029..1595099 (-) | 1071 | WP_000776425.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| ACOCJJ_RS07665 (ACOCJJ_07665) | comGA | 1595071..1596045 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACOCJJ_RS07670 (ACOCJJ_07670) | - | 1596097..1596720 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| ACOCJJ_RS07675 (ACOCJJ_07675) | - | 1596717..1597046 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| ACOCJJ_RS07680 (ACOCJJ_07680) | - | 1597046..1598032 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| ACOCJJ_RS07685 (ACOCJJ_07685) | - | 1598029..1598232 (-) | 204 | WP_000087559.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=986774 ACOCJJ_RS07655 WP_000472256.1 1593704..1594015(-) (comGC) [Staphylococcus aureus strain CBTW2018311]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=986774 ACOCJJ_RS07655 WP_000472256.1 1593704..1594015(-) (comGC) [Staphylococcus aureus strain CBTW2018311]
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |