Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | ACAM23_RS02890 | Genome accession | NZ_AP031394 |
| Coordinates | 540643..540792 (+) | Length | 49 a.a. |
| NCBI ID | WP_001820573.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 16P28 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 535643..545792
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACAM23_RS02840 (SPNE16P28_05540) | comA/nlmT | 535683..536270 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| ACAM23_RS02845 (SPNE16P28_05550) | blpI | 536552..536749 (+) | 198 | WP_001093261.1 | bacteriocin-like peptide BlpI | - |
| ACAM23_RS02850 (SPNE16P28_05570) | blpJ | 537216..537485 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| ACAM23_RS02855 (SPNE16P28_05580) | blpU | 537554..537784 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| ACAM23_RS02860 | - | 537787..537906 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| ACAM23_RS02865 (SPNE16P28_05590) | - | 538203..538367 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| ACAM23_RS02870 (SPNE16P28_05600) | - | 538364..538768 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| ACAM23_RS02875 | - | 538971..539776 (+) | 806 | Protein_566 | IS5 family transposase | - |
| ACAM23_RS02880 (SPNE16P28_05630) | blpM | 539926..540180 (+) | 255 | WP_000379877.1 | two-peptide bacteriocin subunit BlpM | - |
| ACAM23_RS02885 (SPNE16P28_05640) | blpN | 540196..540399 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| ACAM23_RS02890 (SPNE16P28_05650) | cipB | 540643..540792 (+) | 150 | WP_001820573.1 | bacteriocin-like peptide BlpO | Regulator |
| ACAM23_RS02895 | - | 540896..541015 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| ACAM23_RS02900 (SPNE16P28_05670) | - | 541801..542184 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| ACAM23_RS02905 (SPNE16P28_05680) | - | 542236..542925 (+) | 690 | WP_000760510.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ACAM23_RS02910 (SPNE16P28_05690) | blpZ | 542967..543200 (+) | 234 | WP_001818347.1 | immunity protein BlpZ | - |
| ACAM23_RS02915 | - | 543351..543962 (+) | 612 | WP_000394049.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ACAM23_RS02920 (SPNE16P28_05700) | ccrZ | 544123..544917 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| ACAM23_RS02925 (SPNE16P28_05710) | trmB | 544914..545549 (+) | 636 | WP_369608084.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.91 Da Isoelectric Point: 3.9133
>NTDB_id=97660 ACAM23_RS02890 WP_001820573.1 540643..540792(+) (cipB) [Streptococcus pneumoniae strain 16P28]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=97660 ACAM23_RS02890 WP_001820573.1 540643..540792(+) (cipB) [Streptococcus pneumoniae strain 16P28]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |