Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | UXR25_RS04255 | Genome accession | NZ_CP151146 |
| Coordinates | 884542..884970 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus aureus strain BSN152 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 875181..924135 | 884542..884970 | within | 0 |
Gene organization within MGE regions
Location: 875181..924135
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR25_RS04170 (UXR25_04170) | sufB | 875181..876578 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| UXR25_RS04175 (UXR25_04175) | - | 876646..877695 (-) | 1050 | WP_001145726.1 | tyrosine-type recombinase/integrase | - |
| UXR25_RS04180 (UXR25_04180) | - | 877808..877987 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| UXR25_RS04185 (UXR25_04185) | - | 877967..878899 (-) | 933 | WP_000392186.1 | hypothetical protein | - |
| UXR25_RS04190 (UXR25_04190) | - | 878931..879656 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| UXR25_RS04195 (UXR25_04195) | - | 879684..880358 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| UXR25_RS04200 (UXR25_04200) | - | 880375..880707 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| UXR25_RS04205 (UXR25_04205) | - | 880970..881164 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| UXR25_RS04210 (UXR25_04210) | - | 881164..881931 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| UXR25_RS04215 (UXR25_04215) | tscA | 881932..882156 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| UXR25_RS04220 (UXR25_04220) | - | 882196..882645 (+) | 450 | WP_001094943.1 | hypothetical protein | - |
| UXR25_RS04225 (UXR25_04225) | - | 882659..882880 (+) | 222 | WP_000977381.1 | hypothetical protein | - |
| UXR25_RS04230 (UXR25_04230) | - | 882873..883034 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| UXR25_RS04235 (UXR25_04235) | - | 883128..883430 (+) | 303 | WP_000165363.1 | DUF2482 family protein | - |
| UXR25_RS04240 (UXR25_04240) | - | 883435..883695 (+) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| UXR25_RS04245 (UXR25_04245) | - | 883705..883926 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| UXR25_RS04250 (UXR25_04250) | - | 883919..884542 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| UXR25_RS04255 (UXR25_04255) | ssbA | 884542..884970 (+) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| UXR25_RS04260 (UXR25_04260) | - | 884984..885658 (+) | 675 | WP_001124438.1 | putative HNHc nuclease | - |
| UXR25_RS04265 (UXR25_04265) | - | 885655..885804 (+) | 150 | WP_001081076.1 | hypothetical protein | - |
| UXR25_RS04270 (UXR25_04270) | - | 885797..886078 (-) | 282 | WP_000414755.1 | hypothetical protein | - |
| UXR25_RS04275 (UXR25_04275) | - | 886144..886914 (+) | 771 | WP_000190254.1 | conserved phage C-terminal domain-containing protein | - |
| UXR25_RS04280 (UXR25_04280) | - | 886924..887703 (+) | 780 | WP_000803062.1 | ATP-binding protein | - |
| UXR25_RS04285 (UXR25_04285) | - | 887697..887855 (+) | 159 | WP_000256589.1 | hypothetical protein | - |
| UXR25_RS04290 (UXR25_04290) | - | 887868..888089 (+) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| UXR25_RS04295 (UXR25_04295) | - | 888099..888503 (+) | 405 | WP_000049794.1 | DUF1064 domain-containing protein | - |
| UXR25_RS04300 (UXR25_04300) | - | 888508..888693 (+) | 186 | WP_001187243.1 | DUF3113 family protein | - |
| UXR25_RS04305 (UXR25_04305) | - | 888694..888999 (+) | 306 | WP_000101252.1 | hypothetical protein | - |
| UXR25_RS04310 (UXR25_04310) | - | 889127..889483 (+) | 357 | WP_000029376.1 | SA1788 family PVL leukocidin-associated protein | - |
| UXR25_RS04315 (UXR25_04315) | - | 889487..889729 (+) | 243 | WP_000131376.1 | SAV1978 family virulence-associated passenger protein | - |
| UXR25_RS04320 (UXR25_04320) | - | 889738..890109 (+) | 372 | WP_001557190.1 | hypothetical protein | - |
| UXR25_RS04325 (UXR25_04325) | - | 890102..890356 (+) | 255 | WP_001065060.1 | DUF1024 family protein | - |
| UXR25_RS04330 (UXR25_04330) | - | 890343..890513 (+) | 171 | WP_000714412.1 | hypothetical protein | - |
| UXR25_RS04335 (UXR25_04335) | - | 890506..891039 (+) | 534 | WP_000185647.1 | dUTP diphosphatase | - |
| UXR25_RS04340 (UXR25_04340) | - | 891076..891282 (+) | 207 | WP_000617154.1 | DUF1381 domain-containing protein | - |
| UXR25_RS04345 (UXR25_04345) | - | 891279..891473 (+) | 195 | WP_000132921.1 | hypothetical protein | - |
| UXR25_RS04350 (UXR25_04350) | - | 891470..891673 (+) | 204 | WP_001072795.1 | hypothetical protein | - |
| UXR25_RS04355 (UXR25_04355) | - | 891666..891902 (+) | 237 | WP_000608278.1 | hypothetical protein | - |
| UXR25_RS04360 (UXR25_04360) | rinB | 891895..892068 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| UXR25_RS04365 (UXR25_04365) | - | 892069..892170 (+) | 102 | Protein_847 | hypothetical protein | - |
| UXR25_RS04370 (UXR25_04370) | - | 892239..892661 (+) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| UXR25_RS04375 (UXR25_04375) | - | 892849..893343 (+) | 495 | WP_001038244.1 | terminase small subunit | - |
| UXR25_RS04380 (UXR25_04380) | - | 893346..894641 (+) | 1296 | WP_000273011.1 | PBSX family phage terminase large subunit | - |
| UXR25_RS04385 (UXR25_04385) | - | 894652..896190 (+) | 1539 | WP_000909970.1 | phage portal protein | - |
| UXR25_RS04390 (UXR25_04390) | - | 896197..897192 (+) | 996 | WP_156991916.1 | minor capsid protein | - |
| UXR25_RS04395 (UXR25_04395) | - | 897265..897435 (+) | 171 | WP_000072202.1 | hypothetical protein | - |
| UXR25_RS04400 (UXR25_04400) | - | 897463..897550 (+) | 88 | Protein_854 | hypothetical protein | - |
| UXR25_RS04405 (UXR25_04405) | - | 897544..898164 (+) | 621 | WP_341514797.1 | DUF4355 domain-containing protein | - |
| UXR25_RS04410 (UXR25_04410) | - | 898178..899152 (+) | 975 | WP_000438512.1 | phage major capsid protein | - |
| UXR25_RS04415 (UXR25_04415) | - | 899174..899461 (+) | 288 | WP_001114088.1 | hypothetical protein | - |
| UXR25_RS04420 (UXR25_04420) | - | 899470..899802 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| UXR25_RS04425 (UXR25_04425) | - | 899799..900101 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| UXR25_RS04430 (UXR25_04430) | - | 900101..900448 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| UXR25_RS04435 (UXR25_04435) | - | 900460..900843 (+) | 384 | WP_000188645.1 | hypothetical protein | - |
| UXR25_RS04440 (UXR25_04440) | - | 900862..901443 (+) | 582 | WP_015977705.1 | phage major tail protein, TP901-1 family | - |
| UXR25_RS04445 (UXR25_04445) | - | 901505..901870 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| UXR25_RS04450 (UXR25_04450) | - | 901900..902244 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| UXR25_RS04455 (UXR25_04455) | - | 902261..905728 (+) | 3468 | WP_000141480.1 | hypothetical protein | - |
| UXR25_RS04460 (UXR25_04460) | - | 905741..906688 (+) | 948 | WP_000350675.1 | phage tail family protein | - |
| UXR25_RS04465 (UXR25_04465) | - | 906697..908598 (+) | 1902 | WP_000152716.1 | SGNH/GDSL hydrolase family protein | - |
| UXR25_RS04470 (UXR25_04470) | - | 908613..910523 (+) | 1911 | WP_000369003.1 | hypothetical protein | - |
| UXR25_RS04475 (UXR25_04475) | - | 910523..912346 (+) | 1824 | WP_341514798.1 | BppU family phage baseplate upper protein | - |
| UXR25_RS04480 (UXR25_04480) | - | 912346..912723 (+) | 378 | WP_000705896.1 | DUF2977 domain-containing protein | - |
| UXR25_RS04485 (UXR25_04485) | - | 912727..912900 (+) | 174 | WP_000782200.1 | XkdX family protein | - |
| UXR25_RS04490 (UXR25_04490) | - | 912940..913146 (+) | 207 | Protein_872 | DUF2951 family protein | - |
| UXR25_RS04495 (UXR25_04495) | - | 913113..913538 (+) | 426 | Protein_873 | N-acetylglucosaminidase | - |
| UXR25_RS04500 (UXR25_04500) | - | 913551..914789 (+) | 1239 | WP_000276662.1 | BppU family phage baseplate upper protein | - |
| UXR25_RS04505 (UXR25_04505) | - | 914795..915190 (+) | 396 | WP_000398868.1 | hypothetical protein | - |
| UXR25_RS04510 (UXR25_04510) | - | 915246..915521 (+) | 276 | WP_000351119.1 | phage holin | - |
| UXR25_RS04515 (UXR25_04515) | - | 915508..916920 (+) | 1413 | WP_001141517.1 | N-acetylmuramoyl-L-alanine amidase | - |
| UXR25_RS04520 (UXR25_04520) | - | 916980..917537 (-) | 558 | WP_001035620.1 | DUF4888 domain-containing protein | - |
| UXR25_RS04525 (UXR25_04525) | - | 917912..918064 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| UXR25_RS04530 (UXR25_04530) | - | 918135..918245 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| UXR25_RS04535 (UXR25_04535) | - | 918247..918432 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
| UXR25_RS04540 (UXR25_04540) | - | 919117..919256 (+) | 140 | Protein_882 | hypothetical protein | - |
| UXR25_RS04545 (UXR25_04545) | - | 919262..919576 (-) | 315 | WP_000274029.1 | hypothetical protein | - |
| UXR25_RS04550 (UXR25_04550) | - | 919941..920981 (+) | 1041 | WP_000582326.1 | hemolysin family protein | - |
| UXR25_RS04555 (UXR25_04555) | - | 920995..922062 (+) | 1068 | WP_000267236.1 | nitronate monooxygenase family protein | - |
| UXR25_RS04560 (UXR25_04560) | - | 922316..922399 (+) | 84 | WP_016170465.1 | hypothetical protein | - |
| UXR25_RS04565 (UXR25_04565) | - | 922447..923295 (+) | 849 | WP_000608129.1 | DUF72 domain-containing protein | - |
| UXR25_RS04570 (UXR25_04570) | - | 923308..924135 (+) | 828 | WP_000927632.1 | sulfite exporter TauE/SafE family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=975384 UXR25_RS04255 WP_000934385.1 884542..884970(+) (ssbA) [Staphylococcus aureus strain BSN152]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=975384 UXR25_RS04255 WP_000934385.1 884542..884970(+) (ssbA) [Staphylococcus aureus strain BSN152]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |