Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WOC48_RS03335 | Genome accession | NZ_CP150777 |
| Coordinates | 665986..666411 (-) | Length | 141 a.a. |
| NCBI ID | WP_015978401.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM20825 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 632042..678983 | 665986..666411 | within | 0 |
Gene organization within MGE regions
Location: 632042..678983
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC48_RS03100 (WOC48_03090) | - | 632042..632599 (-) | 558 | WP_000528632.1 | PBECR4 domain-containing protein | - |
| WOC48_RS03105 (WOC48_03095) | - | 633258..634703 (-) | 1446 | WP_338627880.1 | SH3 domain-containing protein | - |
| WOC48_RS03110 (WOC48_03100) | - | 634684..635121 (-) | 438 | WP_000354134.1 | phage holin | - |
| WOC48_RS03115 (WOC48_03105) | - | 635177..635572 (-) | 396 | WP_042855627.1 | hypothetical protein | - |
| WOC48_RS03120 (WOC48_03110) | - | 635577..636815 (-) | 1239 | WP_117222187.1 | BppU family phage baseplate upper protein | - |
| WOC48_RS03125 (WOC48_03115) | - | 636828..638702 (-) | 1875 | WP_261921315.1 | glucosaminidase domain-containing protein | - |
| WOC48_RS03130 (WOC48_03120) | - | 638839..639139 (-) | 301 | Protein_622 | DUF2951 domain-containing protein | - |
| WOC48_RS03135 (WOC48_03125) | - | 639180..639353 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| WOC48_RS03140 (WOC48_03130) | - | 639357..639734 (-) | 378 | WP_000705910.1 | DUF2977 domain-containing protein | - |
| WOC48_RS03145 (WOC48_03135) | - | 639734..641557 (-) | 1824 | WP_261921314.1 | phage baseplate upper protein | - |
| WOC48_RS03150 (WOC48_03140) | - | 641557..643455 (-) | 1899 | WP_054189010.1 | hypothetical protein | - |
| WOC48_RS03155 (WOC48_03145) | - | 643468..645354 (-) | 1887 | WP_038412588.1 | SGNH/GDSL hydrolase family protein | - |
| WOC48_RS03160 (WOC48_03150) | - | 645365..646306 (-) | 942 | WP_000560181.1 | phage tail domain-containing protein | - |
| WOC48_RS03165 (WOC48_03155) | - | 646321..649206 (-) | 2886 | WP_368409628.1 | terminase | - |
| WOC48_RS03170 (WOC48_03160) | - | 649210..649494 (-) | 285 | WP_000880587.1 | hypothetical protein | - |
| WOC48_RS03175 (WOC48_03165) | - | 649539..650045 (-) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| WOC48_RS03180 (WOC48_03170) | - | 650112..650669 (-) | 558 | WP_000057583.1 | hypothetical protein | - |
| WOC48_RS03185 (WOC48_03175) | - | 650670..651095 (-) | 426 | WP_000270192.1 | DUF3168 domain-containing protein | - |
| WOC48_RS03190 (WOC48_03180) | - | 651108..651521 (-) | 414 | WP_001151330.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| WOC48_RS03195 (WOC48_03185) | - | 651508..651843 (-) | 336 | WP_000483041.1 | phage head closure protein | - |
| WOC48_RS03200 (WOC48_03190) | - | 651855..652205 (-) | 351 | WP_000177351.1 | phage head-tail adapter protein | - |
| WOC48_RS03205 (WOC48_03195) | - | 652211..652354 (-) | 144 | WP_000002931.1 | hypothetical protein | - |
| WOC48_RS03210 (WOC48_03200) | - | 652366..653280 (-) | 915 | WP_000235168.1 | phage major capsid protein | - |
| WOC48_RS03215 (WOC48_03205) | - | 653297..653881 (-) | 585 | WP_001019219.1 | DUF4355 domain-containing protein | - |
| WOC48_RS03220 (WOC48_03210) | - | 653984..654190 (-) | 207 | WP_000346033.1 | hypothetical protein | - |
| WOC48_RS03225 (WOC48_03215) | - | 654192..655145 (-) | 954 | WP_000184133.1 | phage head morphogenesis protein | - |
| WOC48_RS03230 (WOC48_03220) | - | 655114..656538 (-) | 1425 | WP_000177426.1 | phage portal protein | - |
| WOC48_RS03235 (WOC48_03225) | - | 656535..657758 (-) | 1224 | WP_338627878.1 | PBSX family phage terminase large subunit | - |
| WOC48_RS03240 (WOC48_03230) | - | 657751..658245 (-) | 495 | WP_000594079.1 | terminase small subunit | - |
| WOC48_RS03245 (WOC48_03235) | - | 658598..658999 (-) | 402 | WP_000286968.1 | hypothetical protein | - |
| WOC48_RS03250 (WOC48_03240) | rinB | 659000..659173 (-) | 174 | WP_001657250.1 | transcriptional activator RinB | - |
| WOC48_RS03255 (WOC48_03245) | - | 659166..659369 (-) | 204 | WP_261921313.1 | hypothetical protein | - |
| WOC48_RS03260 (WOC48_03250) | - | 659366..659560 (-) | 195 | WP_000132920.1 | hypothetical protein | - |
| WOC48_RS03265 (WOC48_03255) | - | 659557..659763 (-) | 207 | WP_000195785.1 | DUF1381 domain-containing protein | - |
| WOC48_RS03270 (WOC48_03260) | - | 659800..660309 (-) | 510 | WP_000185636.1 | dUTP diphosphatase | - |
| WOC48_RS03275 (WOC48_03265) | - | 660314..660550 (-) | 237 | WP_001065079.1 | DUF1024 family protein | - |
| WOC48_RS03280 (WOC48_03270) | - | 660565..660813 (-) | 249 | WP_001126846.1 | phi PVL orf 51-like protein | - |
| WOC48_RS03285 (WOC48_03275) | - | 660814..661173 (-) | 360 | WP_001668922.1 | SA1788 family PVL leukocidin-associated protein | - |
| WOC48_RS03290 (WOC48_03280) | - | 661174..661359 (-) | 186 | WP_001187264.1 | DUF3113 family protein | - |
| WOC48_RS03295 (WOC48_03285) | - | 661359..661766 (-) | 408 | WP_000401950.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WOC48_RS03300 (WOC48_03290) | - | 661776..661997 (-) | 222 | WP_001123684.1 | DUF3269 family protein | - |
| WOC48_RS03305 (WOC48_03295) | - | 662010..662168 (-) | 159 | WP_000256597.1 | hypothetical protein | - |
| WOC48_RS03310 (WOC48_03300) | - | 662162..662941 (-) | 780 | WP_001668921.1 | ATP-binding protein | - |
| WOC48_RS03315 (WOC48_03305) | - | 662951..663721 (-) | 771 | WP_261921312.1 | conserved phage C-terminal domain-containing protein | - |
| WOC48_RS03320 (WOC48_03310) | - | 663786..664643 (+) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| WOC48_RS03325 (WOC48_03315) | - | 664749..665423 (-) | 675 | WP_029753391.1 | putative HNHc nuclease | - |
| WOC48_RS03330 (WOC48_03320) | - | 665424..665975 (-) | 552 | WP_001004506.1 | NUMOD4 domain-containing protein | - |
| WOC48_RS03335 (WOC48_03325) | ssbA | 665986..666411 (-) | 426 | WP_015978401.1 | single-stranded DNA-binding protein | Machinery gene |
| WOC48_RS03340 (WOC48_03330) | - | 666411..667034 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| WOC48_RS03345 (WOC48_03335) | - | 667027..667248 (-) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| WOC48_RS03350 (WOC48_03340) | - | 667258..667518 (-) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| WOC48_RS03355 (WOC48_03345) | - | 667610..667771 (-) | 162 | WP_001668917.1 | DUF1270 family protein | - |
| WOC48_RS03360 (WOC48_03350) | - | 667951..668598 (+) | 648 | WP_086153461.1 | hypothetical protein | - |
| WOC48_RS03365 (WOC48_03355) | - | 668620..668763 (-) | 144 | WP_000939498.1 | hypothetical protein | - |
| WOC48_RS03370 (WOC48_03360) | tscA | 668803..669027 (-) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| WOC48_RS03375 (WOC48_03365) | - | 669028..669801 (-) | 774 | WP_001148549.1 | phage antirepressor KilAC domain-containing protein | - |
| WOC48_RS03380 (WOC48_03370) | - | 669824..670051 (-) | 228 | WP_000192117.1 | helix-turn-helix transcriptional regulator | - |
| WOC48_RS03385 (WOC48_03375) | - | 670205..670837 (+) | 633 | WP_000901358.1 | LexA family transcriptional regulator | - |
| WOC48_RS03390 (WOC48_03380) | - | 670888..671433 (+) | 546 | WP_261921311.1 | Ltp family lipoprotein | - |
| WOC48_RS03395 (WOC48_03385) | - | 671549..672229 (+) | 681 | WP_000392106.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| WOC48_RS03400 (WOC48_03390) | - | 672436..673821 (+) | 1386 | WP_000861313.1 | recombinase family protein | - |
| WOC48_RS03405 (WOC48_03395) | rpmF | 673938..674111 (-) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| WOC48_RS03410 (WOC48_03400) | - | 674191..674748 (-) | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| WOC48_RS03415 (WOC48_03405) | - | 674875..676014 (+) | 1140 | WP_000843611.1 | nucleotidyltransferase | - |
| WOC48_RS03420 (WOC48_03410) | coaD | 676076..676558 (-) | 483 | WP_000401377.1 | pantetheine-phosphate adenylyltransferase | - |
| WOC48_RS03425 (WOC48_03415) | rsmD | 676560..677102 (-) | 543 | WP_001263796.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| WOC48_RS03430 (WOC48_03420) | - | 677172..677561 (+) | 390 | WP_000814565.1 | hypothetical protein | - |
| WOC48_RS03435 (WOC48_03425) | - | 677564..677818 (-) | 255 | WP_001049150.1 | YlbG family protein | - |
| WOC48_RS03440 (WOC48_03430) | - | 678057..678983 (+) | 927 | WP_000757597.1 | glycerophosphodiester phosphodiesterase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15947.45 Da Isoelectric Point: 5.8790
>NTDB_id=972437 WOC48_RS03335 WP_015978401.1 665986..666411(-) (ssbA) [Staphylococcus aureus strain TUM20825]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=972437 WOC48_RS03335 WP_015978401.1 665986..666411(-) (ssbA) [Staphylococcus aureus strain TUM20825]
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
74.576 |
83.688 |
0.624 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.603 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.553 |
100 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.688 |
0.376 |