Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC61_RS00595 | Genome accession | NZ_CP150751 |
| Coordinates | 111309..111620 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM22698 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 106309..116620
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC61_RS00565 (WOC61_00560) | - | 107092..107295 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| WOC61_RS00570 (WOC61_00565) | - | 107292..108278 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| WOC61_RS00575 (WOC61_00570) | - | 108278..108607 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC61_RS00580 (WOC61_00575) | - | 108604..109227 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| WOC61_RS00585 (WOC61_00580) | comGA | 109279..110253 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC61_RS00590 (WOC61_00585) | comGB | 110225..111295 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC61_RS00595 (WOC61_00590) | comGC | 111309..111620 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC61_RS00600 (WOC61_00595) | comGD | 111598..112044 (+) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC61_RS00605 (WOC61_00600) | comGE | 112031..112330 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| WOC61_RS00610 (WOC61_00605) | comGF | 112248..112670 (+) | 423 | WP_258922346.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC61_RS00615 (WOC61_00610) | - | 112748..113920 (+) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| WOC61_RS00620 (WOC61_00615) | - | 113973..114077 (+) | 105 | Protein_122 | type IV pilus minor pilin ComGF family protein | - |
| WOC61_RS00625 (WOC61_00620) | - | 114174..114320 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| WOC61_RS00630 (WOC61_00625) | - | 114310..114834 (+) | 525 | WP_001015117.1 | shikimate kinase | - |
| WOC61_RS00635 (WOC61_00630) | gcvT | 114993..116084 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=971778 WOC61_RS00595 WP_000472256.1 111309..111620(+) (comGC) [Staphylococcus aureus strain TUM22698]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=971778 WOC61_RS00595 WP_000472256.1 111309..111620(+) (comGC) [Staphylococcus aureus strain TUM22698]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |