Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WOC43_RS13305 | Genome accession | NZ_CP150749 |
| Coordinates | 2677512..2677937 (-) | Length | 141 a.a. |
| NCBI ID | WP_015978401.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM22699 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2641663..2686260 | 2677512..2677937 | within | 0 |
Gene organization within MGE regions
Location: 2641663..2686260
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC43_RS13050 (WOC43_13050) | - | 2641663..2642220 (-) | 558 | WP_000528632.1 | PBECR4 domain-containing protein | - |
| WOC43_RS13055 (WOC43_13055) | - | 2642844..2644256 (-) | 1413 | WP_154290827.1 | N-acetylmuramoyl-L-alanine amidase | - |
| WOC43_RS13060 (WOC43_13060) | - | 2644243..2644518 (-) | 276 | WP_000351119.1 | phage holin | - |
| WOC43_RS13065 (WOC43_13065) | - | 2644574..2644969 (-) | 396 | WP_000398856.1 | hypothetical protein | - |
| WOC43_RS13070 (WOC43_13070) | - | 2644975..2646213 (-) | 1239 | WP_117219584.1 | BppU family phage baseplate upper protein | - |
| WOC43_RS13075 (WOC43_13075) | - | 2646226..2648124 (-) | 1899 | WP_116485879.1 | glucosaminidase domain-containing protein | - |
| WOC43_RS13080 (WOC43_13080) | - | 2648261..2648560 (-) | 300 | WP_000466778.1 | DUF2951 domain-containing protein | - |
| WOC43_RS13085 (WOC43_13085) | - | 2648600..2648773 (-) | 174 | WP_000782201.1 | XkdX family protein | - |
| WOC43_RS13090 (WOC43_13090) | - | 2648777..2649154 (-) | 378 | WP_096660005.1 | DUF2977 domain-containing protein | - |
| WOC43_RS13095 (WOC43_13095) | - | 2649154..2650977 (-) | 1824 | WP_117219585.1 | phage baseplate upper protein | - |
| WOC43_RS13100 (WOC43_13100) | - | 2650977..2652887 (-) | 1911 | WP_117219586.1 | hypothetical protein | - |
| WOC43_RS13105 (WOC43_13105) | - | 2652902..2654803 (-) | 1902 | WP_000156406.1 | SGNH/GDSL hydrolase family protein | - |
| WOC43_RS13110 (WOC43_13110) | - | 2654812..2655759 (-) | 948 | WP_000350670.1 | phage tail family protein | - |
| WOC43_RS13115 (WOC43_13115) | - | 2655772..2659236 (-) | 3465 | WP_117219587.1 | hypothetical protein | - |
| WOC43_RS13120 (WOC43_13120) | - | 2659253..2659597 (-) | 345 | WP_000105584.1 | hypothetical protein | - |
| WOC43_RS13125 (WOC43_13125) | - | 2659627..2659992 (-) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| WOC43_RS13130 (WOC43_13130) | - | 2660055..2660636 (-) | 582 | WP_000002578.1 | phage major tail protein, TP901-1 family | - |
| WOC43_RS13135 (WOC43_13135) | - | 2660655..2661038 (-) | 384 | WP_000188649.1 | hypothetical protein | - |
| WOC43_RS13140 (WOC43_13140) | - | 2661050..2661397 (-) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| WOC43_RS13145 (WOC43_13145) | - | 2661397..2661699 (-) | 303 | WP_001268313.1 | hypothetical protein | - |
| WOC43_RS13150 (WOC43_13150) | - | 2661696..2662028 (-) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| WOC43_RS13155 (WOC43_13155) | - | 2662037..2662324 (-) | 288 | WP_001114085.1 | hypothetical protein | - |
| WOC43_RS13160 (WOC43_13160) | - | 2662346..2663320 (-) | 975 | WP_000438513.1 | phage major capsid protein | - |
| WOC43_RS13165 (WOC43_13165) | - | 2663334..2663954 (-) | 621 | WP_000392143.1 | DUF4355 domain-containing protein | - |
| WOC43_RS13170 (WOC43_13170) | - | 2663948..2664035 (-) | 88 | Protein_2553 | hypothetical protein | - |
| WOC43_RS13175 (WOC43_13175) | - | 2664063..2664233 (-) | 171 | WP_000072202.1 | hypothetical protein | - |
| WOC43_RS13180 (WOC43_13180) | - | 2664306..2665301 (-) | 996 | WP_368410328.1 | minor capsid protein | - |
| WOC43_RS13185 (WOC43_13185) | - | 2665308..2666843 (-) | 1536 | WP_117219588.1 | phage portal protein | - |
| WOC43_RS13190 (WOC43_13190) | - | 2666854..2668131 (-) | 1278 | WP_000169946.1 | PBSX family phage terminase large subunit | - |
| WOC43_RS13195 (WOC43_13195) | - | 2668118..2668558 (-) | 441 | WP_001003272.1 | terminase small subunit | - |
| WOC43_RS13200 (WOC43_13200) | - | 2668745..2669167 (-) | 423 | WP_000162696.1 | RinA family phage transcriptional activator | - |
| WOC43_RS13205 (WOC43_13205) | - | 2669191..2669337 (-) | 147 | WP_009560343.1 | hypothetical protein | - |
| WOC43_RS13210 (WOC43_13210) | rinB | 2669338..2669511 (-) | 174 | WP_103146799.1 | transcriptional activator RinB | - |
| WOC43_RS13215 (WOC43_13215) | - | 2669511..2669894 (-) | 384 | WP_406846215.1 | hypothetical protein | - |
| WOC43_RS13220 (WOC43_13220) | - | 2669891..2670097 (-) | 207 | WP_031863839.1 | DUF1381 domain-containing protein | - |
| WOC43_RS13225 (WOC43_13225) | - | 2670134..2670664 (-) | 531 | WP_000185662.1 | dUTPase | - |
| WOC43_RS13230 (WOC43_13230) | - | 2670657..2670886 (-) | 230 | Protein_2565 | DUF1024 family protein | - |
| WOC43_RS13235 (WOC43_13235) | - | 2670879..2671244 (-) | 366 | WP_001105615.1 | hypothetical protein | - |
| WOC43_RS13240 (WOC43_13240) | - | 2671241..2671645 (-) | 405 | WP_117219590.1 | hypothetical protein | - |
| WOC43_RS13245 (WOC43_13245) | - | 2671658..2671900 (-) | 243 | WP_000131395.1 | SAV1978 family virulence-associated passenger protein | - |
| WOC43_RS13250 (WOC43_13250) | - | 2671904..2672260 (-) | 357 | WP_065315834.1 | SA1788 family PVL leukocidin-associated protein | - |
| WOC43_RS13255 (WOC43_13255) | - | 2672388..2672693 (-) | 306 | WP_029051971.1 | hypothetical protein | - |
| WOC43_RS13260 (WOC43_13260) | - | 2672694..2672879 (-) | 186 | WP_029051970.1 | DUF3113 family protein | - |
| WOC43_RS13265 (WOC43_13265) | - | 2672884..2673288 (-) | 405 | WP_000049798.1 | DUF1064 domain-containing protein | - |
| WOC43_RS13270 (WOC43_13270) | - | 2673299..2673520 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| WOC43_RS13275 (WOC43_13275) | - | 2673533..2673694 (-) | 162 | WP_000237153.1 | hypothetical protein | - |
| WOC43_RS13280 (WOC43_13280) | - | 2673688..2674467 (-) | 780 | WP_000803065.1 | ATP-binding protein | - |
| WOC43_RS13285 (WOC43_13285) | - | 2674477..2675247 (-) | 771 | WP_000190224.1 | conserved phage C-terminal domain-containing protein | - |
| WOC43_RS13290 (WOC43_13290) | - | 2675312..2676169 (+) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| WOC43_RS13295 (WOC43_13295) | - | 2676275..2676949 (-) | 675 | WP_029753391.1 | putative HNHc nuclease | - |
| WOC43_RS13300 (WOC43_13300) | - | 2676950..2677501 (-) | 552 | WP_001004506.1 | NUMOD4 domain-containing protein | - |
| WOC43_RS13305 (WOC43_13305) | ssbA | 2677512..2677937 (-) | 426 | WP_015978401.1 | single-stranded DNA-binding protein | Machinery gene |
| WOC43_RS13310 (WOC43_13310) | - | 2677937..2678560 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| WOC43_RS13315 (WOC43_13315) | - | 2678553..2678774 (-) | 222 | WP_000815402.1 | DUF2483 family protein | - |
| WOC43_RS13320 (WOC43_13320) | - | 2678784..2679044 (-) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| WOC43_RS13325 (WOC43_13325) | - | 2679138..2679299 (-) | 162 | WP_031783957.1 | DUF1270 family protein | - |
| WOC43_RS13330 (WOC43_13330) | - | 2679479..2679709 (+) | 231 | WP_000395457.1 | hypothetical protein | - |
| WOC43_RS13335 (WOC43_13335) | - | 2679684..2679860 (-) | 177 | WP_001094935.1 | hypothetical protein | - |
| WOC43_RS13340 (WOC43_13340) | - | 2679916..2680125 (+) | 210 | WP_000033736.1 | hypothetical protein | - |
| WOC43_RS13345 (WOC43_13345) | - | 2680114..2680284 (-) | 171 | WP_000398751.1 | hypothetical protein | - |
| WOC43_RS13350 (WOC43_13350) | - | 2680355..2681122 (-) | 768 | WP_000282677.1 | DUF6551 family protein | - |
| WOC43_RS13355 (WOC43_13355) | - | 2681115..2681996 (-) | 882 | WP_000904049.1 | ParB N-terminal domain-containing protein | - |
| WOC43_RS13360 (WOC43_13360) | - | 2682036..2682245 (-) | 210 | WP_001113664.1 | helix-turn-helix transcriptional regulator | - |
| WOC43_RS13365 (WOC43_13365) | - | 2682408..2682734 (+) | 327 | WP_000455972.1 | helix-turn-helix domain-containing protein | - |
| WOC43_RS13370 (WOC43_13370) | - | 2682756..2683214 (+) | 459 | WP_000521394.1 | ImmA/IrrE family metallo-endopeptidase | - |
| WOC43_RS13375 (WOC43_13375) | - | 2683232..2683957 (+) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| WOC43_RS13380 (WOC43_13380) | - | 2683989..2684669 (+) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| WOC43_RS13385 (WOC43_13385) | - | 2684875..2686260 (+) | 1386 | WP_117219591.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15947.45 Da Isoelectric Point: 5.8790
>NTDB_id=971767 WOC43_RS13305 WP_015978401.1 2677512..2677937(-) (ssbA) [Staphylococcus aureus strain TUM22699]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=971767 WOC43_RS13305 WP_015978401.1 2677512..2677937(-) (ssbA) [Staphylococcus aureus strain TUM22699]
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAATAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAATAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
74.576 |
83.688 |
0.624 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.603 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.553 |
100 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.688 |
0.376 |