Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC69_RS00600 | Genome accession | NZ_CP150744 |
| Coordinates | 113340..113651 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM22702 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 108340..118651
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC69_RS00570 (WOC69_00570) | - | 109123..109326 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| WOC69_RS00575 (WOC69_00575) | - | 109323..110309 (+) | 987 | WP_000161311.1 | ROK family glucokinase | - |
| WOC69_RS00580 (WOC69_00580) | - | 110309..110638 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC69_RS00585 (WOC69_00585) | - | 110635..111258 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| WOC69_RS00590 (WOC69_00590) | comGA | 111310..112284 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC69_RS00595 (WOC69_00595) | comGB | 112256..113326 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC69_RS00600 (WOC69_00600) | comGC | 113340..113651 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC69_RS00605 (WOC69_00605) | comGD | 113629..114075 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC69_RS00610 (WOC69_00610) | comGE | 114062..114361 (+) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| WOC69_RS00615 (WOC69_00615) | comGF | 114279..114776 (+) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC69_RS00620 (WOC69_00620) | - | 114873..115019 (+) | 147 | WP_001792109.1 | hypothetical protein | - |
| WOC69_RS00625 (WOC69_00625) | - | 115009..115533 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| WOC69_RS00630 (WOC69_00630) | gcvT | 115692..116783 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WOC69_RS00635 (WOC69_00635) | gcvPA | 116803..118149 (+) | 1347 | WP_341262150.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=971641 WOC69_RS00600 WP_000472256.1 113340..113651(+) (comGC) [Staphylococcus aureus strain TUM22702]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=971641 WOC69_RS00600 WP_000472256.1 113340..113651(+) (comGC) [Staphylococcus aureus strain TUM22702]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |