Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC46_RS07570 | Genome accession | NZ_CP150733 |
| Coordinates | 1524196..1524507 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM22741 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1519196..1529507
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC46_RS07540 (WOC46_07540) | - | 1519979..1520182 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| WOC46_RS07545 (WOC46_07545) | - | 1520179..1521165 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| WOC46_RS07550 (WOC46_07550) | - | 1521165..1521494 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC46_RS07555 (WOC46_07555) | - | 1521491..1522114 (+) | 624 | WP_001223010.1 | MBL fold metallo-hydrolase | - |
| WOC46_RS07560 (WOC46_07560) | comGA | 1522166..1523140 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC46_RS07565 (WOC46_07565) | comGB | 1523112..1524182 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC46_RS07570 (WOC46_07570) | comGC | 1524196..1524507 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC46_RS07575 (WOC46_07575) | comGD | 1524485..1524931 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC46_RS07580 (WOC46_07580) | comGE | 1524918..1525217 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| WOC46_RS07585 (WOC46_07585) | comGF | 1525135..1525632 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC46_RS07590 (WOC46_07590) | - | 1525729..1525875 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| WOC46_RS07595 (WOC46_07595) | - | 1525865..1526389 (+) | 525 | WP_001015121.1 | shikimate kinase | - |
| WOC46_RS07600 (WOC46_07600) | gcvT | 1526548..1527639 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WOC46_RS07605 (WOC46_07605) | gcvPA | 1527659..1529005 (+) | 1347 | WP_117200971.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=971398 WOC46_RS07570 WP_000472256.1 1524196..1524507(+) (comGC) [Staphylococcus aureus strain TUM22741]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=971398 WOC46_RS07570 WP_000472256.1 1524196..1524507(+) (comGC) [Staphylococcus aureus strain TUM22741]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |