Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | UXR46_RS10570 | Genome accession | NZ_CP148079 |
| Coordinates | 2052389..2052700 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BSN155-2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2047389..2057700
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR46_RS10540 (UXR46_10540) | - | 2048172..2048375 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| UXR46_RS10545 (UXR46_10545) | - | 2048372..2049358 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| UXR46_RS10550 (UXR46_10550) | - | 2049358..2049687 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| UXR46_RS10555 (UXR46_10555) | - | 2049684..2050307 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| UXR46_RS10560 (UXR46_10560) | comGA | 2050359..2051333 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| UXR46_RS10565 (UXR46_10565) | comGB | 2051305..2052375 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| UXR46_RS10570 (UXR46_10570) | comGC | 2052389..2052700 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| UXR46_RS10575 (UXR46_10575) | comGD | 2052678..2053124 (+) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| UXR46_RS10580 (UXR46_10580) | comGE | 2053111..2053410 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| UXR46_RS10585 (UXR46_10585) | comGF | 2053328..2053825 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| UXR46_RS10590 (UXR46_10590) | - | 2053922..2054068 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| UXR46_RS10595 (UXR46_10595) | - | 2054058..2054582 (+) | 525 | WP_001015117.1 | shikimate kinase | - |
| UXR46_RS10600 (UXR46_10600) | gcvT | 2054741..2055832 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| UXR46_RS10605 (UXR46_10605) | gcvPA | 2055852..2057198 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=950345 UXR46_RS10570 WP_000472256.1 2052389..2052700(+) (comGC) [Staphylococcus aureus strain BSN155-2]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=950345 UXR46_RS10570 WP_000472256.1 2052389..2052700(+) (comGC) [Staphylococcus aureus strain BSN155-2]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |