Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | UXR38_RS07515 | Genome accession | NZ_CP147872 |
| Coordinates | 1577840..1578151 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BSN131 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1572840..1583151
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR38_RS07480 (UXR38_07480) | gcvPA | 1573342..1574688 (-) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| UXR38_RS07485 (UXR38_07485) | gcvT | 1574708..1575799 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| UXR38_RS07490 (UXR38_07490) | - | 1575958..1576482 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| UXR38_RS07495 (UXR38_07495) | - | 1576472..1576618 (-) | 147 | WP_001792109.1 | hypothetical protein | - |
| UXR38_RS07500 (UXR38_07500) | comGF | 1576715..1577212 (-) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| UXR38_RS07505 (UXR38_07505) | comGE | 1577130..1577429 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| UXR38_RS07510 (UXR38_07510) | comGD | 1577416..1577862 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| UXR38_RS07515 (UXR38_07515) | comGC | 1577840..1578151 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| UXR38_RS07520 (UXR38_07520) | comGB | 1578165..1579235 (-) | 1071 | WP_064265422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| UXR38_RS07525 (UXR38_07525) | comGA | 1579207..1580181 (-) | 975 | WP_000697221.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| UXR38_RS07530 (UXR38_07530) | - | 1580233..1580856 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| UXR38_RS07535 (UXR38_07535) | - | 1580853..1581182 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| UXR38_RS07540 (UXR38_07540) | - | 1581182..1582168 (-) | 987 | WP_000161311.1 | ROK family glucokinase | - |
| UXR38_RS07545 (UXR38_07545) | - | 1582165..1582368 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=949078 UXR38_RS07515 WP_000472256.1 1577840..1578151(-) (comGC) [Staphylococcus aureus strain BSN131]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=949078 UXR38_RS07515 WP_000472256.1 1577840..1578151(-) (comGC) [Staphylococcus aureus strain BSN131]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |