Detailed information NTG0949014

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: WDW95_RS10475
• Genome accession: NZ_CP147857
• Coordinates: 2094998..2095318 (-)
• Length: 106 a.a.
• NCBI ID: WP_061774318.1
• Uniprot ID: A0A290PY35
• Organism: Lactococcus raffinolactis strain APC3967
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2089998..2100318

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
WDW95_RS10435	-	2090524..2091294 (-)	771	WP_244165990.1	metal ABC transporter ATP-binding protein	-
WDW95_RS10440	-	2091294..2091743 (-)	450	WP_096039675.1	zinc-dependent MarR family transcriptional regulator	-
WDW95_RS10445	-	2091819..2092667 (-)	849	WP_167838309.1	aminotransferase class IV	-
WDW95_RS10450	ispE	2092751..2093602 (-)	852	WP_061774322.1	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	-
WDW95_RS10455	comGG	2093607..2093891 (-)	285	WP_368651551.1	competence type IV pilus minor pilin ComGG	-
WDW95_RS10460	comGF	2093903..2094346 (-)	444	WP_244165991.1	competence type IV pilus minor pilin ComGF	-
WDW95_RS10465	comGE	2094321..2094626 (-)	306	WP_082785376.1	competence type IV pilus minor pilin ComGE	-
WDW95_RS10470	comGD	2094598..2095083 (-)	486	WP_368651552.1	competence type IV pilus minor pilin ComGD	-
WDW95_RS10475	comYC	2094998..2095318 (-)	321	WP_061774318.1	competence type IV pilus major pilin ComGC	Machinery gene
WDW95_RS10480	comYB	2095327..2096394 (-)	1068	WP_368651553.1	competence type IV pilus assembly protein ComGB	Machinery gene
WDW95_RS10485	comGA/cglA/cilD	2096276..2097217 (-)	942	WP_061774317.1	competence type IV pilus ATPase ComGA	Machinery gene
WDW95_RS10490	-	2097280..2099124 (-)	1845	WP_096039681.1	acyltransferase family protein	-
WDW95_RS10495	-	2099121..2099483 (-)	363	WP_061774315.1	hypothetical protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11969.96 Da
• Isoelectric Point: 9.8991

>NTDB_id=949014 WDW95_RS10475 WP_061774318.1 2094998..2095318(-) (comYC) [Lactococcus raffinolactis strain APC3967]
MKKEDMKKKIVRAFTLVEMLVVLLVISVLILLFIPNLSKQKETVKNTGNGAVVKVVNSQAELYRLDHTDDVTLGKLVSNG
NITQKQADAYNEYYKKNTTESREIPS

Nucleotide

• Length: 321 bp

>NTDB_id=949014 WDW95_RS10475 WP_061774318.1 2094998..2095318(-) (comYC) [Lactococcus raffinolactis strain APC3967]
CTGAAGAAAGAAGATATGAAGAAAAAAATAGTACGTGCTTTTACTTTAGTAGAAATGCTAGTTGTTCTTCTTGTCATTAG
TGTCTTAATTTTATTGTTTATCCCCAATCTATCCAAACAAAAAGAGACTGTTAAGAATACAGGAAACGGCGCTGTTGTAA
AGGTAGTTAACTCGCAAGCGGAACTTTATAGATTAGACCATACTGATGATGTTACCTTAGGCAAGCTAGTCAGCAATGGC
AATATCACACAAAAACAGGCGGATGCTTATAATGAGTACTATAAGAAGAACACAACAGAATCACGTGAAATTCCAAGCTA
G

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-32)

3D structure

• AlphaFold DB: A0A290PY35

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	66.337	95.283	0.632
comYC	Streptococcus mutans UA159	61.538	98.113	0.604
comYC	Streptococcus mutans UA140	61.538	98.113	0.604
comGC/cglC	Streptococcus mitis SK321	63.636	93.396	0.594
comGC/cglC	Streptococcus mitis NCTC 12261	62.887	91.509	0.575
comGC/cglC	Streptococcus pneumoniae R6	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae D39	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae TIGR4	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae Rx1	60.606	93.396	0.566
comGC	Lactococcus lactis subsp. cremoris KW2	59.783	86.792	0.519
comYC	Streptococcus suis isolate S10	57.5	75.472	0.434