Detailed information NTG0948975

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: WDW95_RS01030
• Genome accession: NZ_CP147857
• Coordinates: 193880..194275 (+)
• Length: 131 a.a.
• NCBI ID: WP_031366343.1
• Uniprot ID: A0A1K2H9Q1
• Organism: Lactococcus raffinolactis strain APC3967
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	179414..198704	193880..194275	within	0

Gene organization within MGE regions

Location: 179414..198704

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
WDW95_RS00975	-	179414..180349 (+)	936	WP_368651637.1	glycosyltransferase family 2 protein	-
WDW95_RS00980	-	180465..181745 (+)	1281	WP_368651638.1	hypothetical protein	-
WDW95_RS00985	-	181773..182723 (-)	951	WP_167838252.1	IS30 family transposase	-
WDW95_RS00990	-	183130..185073 (+)	1944	WP_368651639.1	Ig-like domain-containing protein	-
WDW95_RS00995	-	185086..185442 (+)	357	WP_368651640.1	hypothetical protein	-
WDW95_RS01000	-	185628..188132 (+)	2505	WP_368651641.1	GH25 family lysozyme	-
WDW95_RS01005	-	188326..191250 (+)	2925	WP_368651642.1	glucosaminidase domain-containing protein	-
WDW95_RS01010	pepA	191308..192393 (-)	1086	WP_368651643.1	glutamyl aminopeptidase	-
WDW95_RS01015	-	192533..192847 (+)	315	WP_031366346.1	hypothetical protein	-
WDW95_RS01020	-	192849..193166 (+)	318	WP_167841789.1	thioredoxin family protein	-
WDW95_RS01025	ytpR	193198..193821 (+)	624	WP_368651644.1	YtpR family tRNA-binding protein	-
WDW95_RS01030	ssbB	193880..194275 (+)	396	WP_031366343.1	single-stranded DNA-binding protein	Machinery gene
WDW95_RS01035	groES	194481..194765 (+)	285	WP_003138237.1	co-chaperone GroES	-
WDW95_RS01040	groL	194824..196455 (+)	1632	WP_167841792.1	chaperonin GroEL	-
WDW95_RS01045	-	196560..197081 (-)	522	WP_167838359.1	hypothetical protein	-
WDW95_RS01050	-	197412..198704 (+)	1293	WP_368651645.1	adenylosuccinate synthase	-

Sequence

Protein

• Length: 131 a.a.
• Molecular weight: 14729.89 Da
• Isoelectric Point: 5.9329

>NTDB_id=948975 WDW95_RS01030 WP_031366343.1 193880..194275(+) (ssbB) [Lactococcus raffinolactis strain APC3967]
MLNKSLLIGRLTAQPEVKKTPTDKSVLRVTLAVSRQFKTADGQREADFLTIVIWGKPAELFASYAKKGSLVSIEGELRTR
RYEDKTGVTHYVTEVLCQQFNLLESRAAVALRENQVDDVSDVMLEAEELPF

Nucleotide

• Length: 396 bp

>NTDB_id=948975 WDW95_RS01030 WP_031366343.1 193880..194275(+) (ssbB) [Lactococcus raffinolactis strain APC3967]
ATGTTAAATAAGAGTTTATTAATTGGTCGTTTGACCGCACAGCCGGAAGTGAAAAAAACGCCGACGGATAAATCCGTCTT
GCGCGTGACCTTAGCGGTTAGTCGGCAGTTTAAGACTGCTGACGGCCAACGCGAGGCAGATTTTTTGACCATTGTCATCT
GGGGGAAACCAGCAGAGTTGTTCGCTTCTTATGCTAAAAAAGGGAGTCTGGTCTCAATCGAGGGAGAACTACGGACACGA
CGGTATGAAGACAAGACGGGTGTGACTCACTATGTGACGGAAGTCCTATGCCAGCAGTTTAATTTACTAGAAAGCCGCGC
TGCCGTTGCTTTAAGAGAAAATCAAGTGGATGATGTCTCAGACGTGATGTTAGAGGCTGAAGAATTACCATTTTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-102)

3D structure

• AlphaFold DB: A0A1K2H9Q1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Streptococcus sobrinus strain NIDR 6715-7	64.394	100	0.649
ssbA	Streptococcus mutans UA159	62.879	100	0.634
ssbB/cilA	Streptococcus mitis NCTC 12261	59.848	100	0.603
ssbB/cilA	Streptococcus pneumoniae TIGR4	59.848	100	0.603
ssbB/cilA	Streptococcus pneumoniae Rx1	59.091	100	0.595
ssbB/cilA	Streptococcus pneumoniae D39	59.091	100	0.595
ssbB/cilA	Streptococcus pneumoniae R6	59.091	100	0.595
ssbB/cilA	Streptococcus mitis SK321	59.091	100	0.595
ssbB	Lactococcus lactis subsp. cremoris KW2	60	87.786	0.527
ssb	Latilactobacillus sakei subsp. sakei 23K	47.788	86.26	0.412
ssbA	Bacillus subtilis subsp. subtilis str. 168	45.283	80.916	0.366