Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | V8H05_RS05960 | Genome accession | NZ_CP146213 |
| Coordinates | 1195024..1195452 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934793.1 | Uniprot ID | A0A6B3IY96 |
| Organism | Staphylococcus aureus strain KWT 2019-23549 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1187760..1231236 | 1195024..1195452 | within | 0 |
Gene organization within MGE regions
Location: 1187760..1231236
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V8H05_RS05890 (V8H05_05890) | - | 1187760..1189145 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| V8H05_RS05895 (V8H05_05895) | - | 1189352..1190032 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| V8H05_RS05900 (V8H05_05900) | - | 1190148..1190693 (-) | 546 | WP_000391577.1 | Ltp family lipoprotein | - |
| V8H05_RS05905 (V8H05_05905) | - | 1190744..1191376 (-) | 633 | WP_000901358.1 | XRE family transcriptional regulator | - |
| V8H05_RS05910 (V8H05_05910) | - | 1191530..1191757 (+) | 228 | WP_000192117.1 | helix-turn-helix transcriptional regulator | - |
| V8H05_RS05915 (V8H05_05915) | - | 1191780..1192553 (+) | 774 | WP_001148549.1 | phage antirepressor KilAC domain-containing protein | - |
| V8H05_RS05920 (V8H05_05920) | - | 1192554..1192778 (+) | 225 | WP_000187184.1 | hypothetical protein | - |
| V8H05_RS05925 (V8H05_05925) | - | 1192818..1192994 (+) | 177 | WP_000993179.1 | hypothetical protein | - |
| V8H05_RS05930 (V8H05_05930) | - | 1192969..1193199 (-) | 231 | WP_000395455.1 | hypothetical protein | - |
| V8H05_RS05935 (V8H05_05935) | - | 1193258..1193395 (+) | 138 | WP_001568566.1 | hypothetical protein | - |
| V8H05_RS05940 (V8H05_05940) | - | 1193379..1193540 (+) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| V8H05_RS05945 (V8H05_05945) | - | 1193632..1193892 (+) | 261 | WP_000291092.1 | DUF1108 family protein | - |
| V8H05_RS05950 (V8H05_05950) | - | 1193907..1194386 (+) | 480 | WP_000002510.1 | siphovirus Gp157 family protein | - |
| V8H05_RS05955 (V8H05_05955) | - | 1194386..1195024 (+) | 639 | WP_001043064.1 | ERF family protein | - |
| V8H05_RS05960 (V8H05_05960) | ssbA | 1195024..1195452 (+) | 429 | WP_000934793.1 | single-stranded DNA-binding protein | Machinery gene |
| V8H05_RS05965 (V8H05_05965) | - | 1195466..1196140 (+) | 675 | WP_338616734.1 | putative HNHc nuclease | - |
| V8H05_RS05970 (V8H05_05970) | - | 1196133..1196888 (+) | 756 | WP_001037657.1 | DnaD domain protein | - |
| V8H05_RS05975 (V8H05_05975) | - | 1196888..1197244 (+) | 357 | WP_001132243.1 | hypothetical protein | - |
| V8H05_RS05980 (V8H05_05980) | - | 1197241..1198482 (+) | 1242 | WP_001106167.1 | DnaB helicase C-terminal domain-containing protein | - |
| V8H05_RS05985 (V8H05_05985) | - | 1198479..1198694 (+) | 216 | WP_001095146.1 | hypothetical protein | - |
| V8H05_RS05990 (V8H05_05990) | - | 1198697..1198918 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| V8H05_RS05995 (V8H05_05995) | - | 1198928..1199353 (+) | 426 | WP_000451861.1 | phage N-6-adenine-methyltransferase | - |
| V8H05_RS06000 (V8H05_06000) | - | 1199350..1199754 (+) | 405 | WP_000049779.1 | DUF1064 domain-containing protein | - |
| V8H05_RS06005 (V8H05_06005) | - | 1199759..1199944 (+) | 186 | WP_001187237.1 | DUF3113 family protein | - |
| V8H05_RS06010 (V8H05_06010) | - | 1199945..1200304 (+) | 360 | Protein_1178 | SA1788 family PVL leukocidin-associated protein | - |
| V8H05_RS06015 (V8H05_06015) | - | 1200304..1200558 (+) | 255 | WP_000022735.1 | DUF3310 domain-containing protein | - |
| V8H05_RS06020 (V8H05_06020) | - | 1200558..1200806 (+) | 249 | WP_012068339.1 | SAV1978 family virulence-associated passenger protein | - |
| V8H05_RS06025 (V8H05_06025) | - | 1200821..1201222 (+) | 402 | WP_000695761.1 | hypothetical protein | - |
| V8H05_RS06030 (V8H05_06030) | - | 1201219..1201503 (+) | 285 | WP_001105618.1 | hypothetical protein | - |
| V8H05_RS06035 (V8H05_06035) | - | 1201496..1201744 (+) | 249 | WP_338616743.1 | DUF1024 family protein | - |
| V8H05_RS06040 (V8H05_06040) | - | 1201737..1202246 (+) | 510 | WP_000185649.1 | dUTP pyrophosphatase | - |
| V8H05_RS06045 (V8H05_06045) | - | 1202283..1202489 (+) | 207 | WP_044120006.1 | DUF1381 domain-containing protein | - |
| V8H05_RS06050 (V8H05_06050) | - | 1202486..1202689 (+) | 204 | WP_001072794.1 | hypothetical protein | - |
| V8H05_RS06055 (V8H05_06055) | - | 1202682..1202918 (+) | 237 | WP_000608278.1 | hypothetical protein | - |
| V8H05_RS06060 (V8H05_06060) | - | 1202908..1203297 (+) | 390 | WP_171019343.1 | hypothetical protein | - |
| V8H05_RS06065 (V8H05_06065) | - | 1203294..1203467 (+) | 174 | WP_000595243.1 | transcriptional activator RinB | - |
| V8H05_RS06070 (V8H05_06070) | - | 1203468..1203614 (+) | 147 | WP_000989999.1 | hypothetical protein | - |
| V8H05_RS06075 (V8H05_06075) | - | 1203629..1204048 (+) | 420 | WP_000058632.1 | transcriptional regulator | - |
| V8H05_RS06080 (V8H05_06080) | - | 1204235..1204675 (+) | 441 | WP_001003271.1 | terminase small subunit | - |
| V8H05_RS06085 (V8H05_06085) | - | 1204662..1205939 (+) | 1278 | WP_000169944.1 | PBSX family phage terminase large subunit | - |
| V8H05_RS06090 (V8H05_06090) | - | 1205950..1207485 (+) | 1536 | WP_000921895.1 | phage portal protein | - |
| V8H05_RS06095 (V8H05_06095) | - | 1207492..1208487 (+) | 996 | WP_001824750.1 | minor capsid protein | - |
| V8H05_RS06100 (V8H05_06100) | - | 1208560..1208640 (+) | 81 | Protein_1196 | hypothetical protein | - |
| V8H05_RS06105 (V8H05_06105) | - | 1208865..1209479 (+) | 615 | WP_000354306.1 | DUF4355 domain-containing protein | - |
| V8H05_RS06110 (V8H05_06110) | - | 1209493..1210467 (+) | 975 | WP_338616755.1 | phage major capsid protein | - |
| V8H05_RS06115 (V8H05_06115) | - | 1210489..1210776 (+) | 288 | WP_001114086.1 | hypothetical protein | - |
| V8H05_RS06120 (V8H05_06120) | - | 1210785..1211117 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| V8H05_RS06125 (V8H05_06125) | - | 1211114..1211416 (+) | 303 | WP_001268307.1 | hypothetical protein | - |
| V8H05_RS06130 (V8H05_06130) | - | 1211416..1211763 (+) | 348 | WP_001017813.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| V8H05_RS06135 (V8H05_06135) | - | 1211775..1212158 (+) | 384 | WP_000188654.1 | hypothetical protein | - |
| V8H05_RS06140 (V8H05_06140) | - | 1212177..1212758 (+) | 582 | WP_000002580.1 | phage major tail protein, TP901-1 family | - |
| V8H05_RS06145 (V8H05_06145) | - | 1212822..1213187 (+) | 366 | WP_001100168.1 | tail assembly chaperone | - |
| V8H05_RS06150 (V8H05_06150) | - | 1213217..1213561 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| V8H05_RS06155 (V8H05_06155) | - | 1213578..1217042 (+) | 3465 | WP_000141461.1 | hypothetical protein | - |
| V8H05_RS06160 (V8H05_06160) | - | 1217055..1218002 (+) | 948 | WP_000350680.1 | phage tail family protein | - |
| V8H05_RS06165 (V8H05_06165) | - | 1218011..1219912 (+) | 1902 | WP_000156403.1 | SGNH/GDSL hydrolase family protein | - |
| V8H05_RS06170 (V8H05_06170) | - | 1219927..1221837 (+) | 1911 | WP_338616763.1 | hypothetical protein | - |
| V8H05_RS06175 (V8H05_06175) | - | 1221837..1223660 (+) | 1824 | WP_338616765.1 | BppU family phage baseplate upper protein | - |
| V8H05_RS06180 (V8H05_06180) | - | 1223660..1224037 (+) | 378 | WP_112366597.1 | DUF2977 domain-containing protein | - |
| V8H05_RS06185 (V8H05_06185) | - | 1224041..1224214 (+) | 174 | WP_000782199.1 | XkdX family protein | - |
| V8H05_RS06190 (V8H05_06190) | - | 1224254..1224553 (+) | 300 | WP_001817316.1 | DUF2951 domain-containing protein | - |
| V8H05_RS06195 (V8H05_06195) | - | 1224690..1226588 (+) | 1899 | WP_000524011.1 | glucosaminidase domain-containing protein | - |
| V8H05_RS06200 (V8H05_06200) | - | 1226601..1227839 (+) | 1239 | WP_000276632.1 | BppU family phage baseplate upper protein | - |
| V8H05_RS06205 (V8H05_06205) | - | 1227844..1228239 (+) | 396 | WP_000398880.1 | hypothetical protein | - |
| V8H05_RS06210 (V8H05_06210) | - | 1228295..1228732 (+) | 438 | WP_000354133.1 | phage holin | - |
| V8H05_RS06215 (V8H05_06215) | - | 1228713..1230158 (+) | 1446 | WP_001148120.1 | SH3 domain-containing protein | - |
| V8H05_RS06220 (V8H05_06220) | - | 1230555..1230866 (+) | 312 | WP_000344116.1 | DUF3467 domain-containing protein | - |
| V8H05_RS06225 (V8H05_06225) | - | 1230853..1231236 (+) | 384 | WP_001251275.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16059.69 Da Isoelectric Point: 5.8698
>NTDB_id=942042 V8H05_RS05960 WP_000934793.1 1195024..1195452(+) (ssbA) [Staphylococcus aureus strain KWT 2019-23549]
MLNRVVLVGRLTKDPEFRTTPNGVSVATFTLAVNRTFTNAQGEREADFINCVTFRKQADNVNNYLSKGSLAGVDGRLQSR
SYENQEGRRVFVTEVVCDSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTIAITDDDLPF
MLNRVVLVGRLTKDPEFRTTPNGVSVATFTLAVNRTFTNAQGEREADFINCVTFRKQADNVNNYLSKGSLAGVDGRLQSR
SYENQEGRRVFVTEVVCDSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTIAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=942042 V8H05_RS05960 WP_000934793.1 1195024..1195452(+) (ssbA) [Staphylococcus aureus strain KWT 2019-23549]
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTCAGAACAACGCCAAACGGTGTAAGTGTAGC
TACTTTCACTCTTGCAGTCAATAGAACATTCACAAACGCACAAGGAGAACGTGAGGCAGATTTTATTAATTGTGTAACTT
TTAGAAAACAAGCAGATAACGTGAATAACTATTTATCAAAAGGATCATTAGCTGGTGTTGACGGACGCCTACAATCACGT
AGTTATGAAAATCAAGAAGGTCGTCGTGTATTCGTTACCGAAGTTGTATGTGACAGTGTCCAATTCCTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCATTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTCAGAACAACGCCAAACGGTGTAAGTGTAGC
TACTTTCACTCTTGCAGTCAATAGAACATTCACAAACGCACAAGGAGAACGTGAGGCAGATTTTATTAATTGTGTAACTT
TTAGAAAACAAGCAGATAACGTGAATAACTATTTATCAAAAGGATCATTAGCTGGTGTTGACGGACGCCTACAATCACGT
AGTTATGAAAATCAAGAAGGTCGTCGTGTATTCGTTACCGAAGTTGTATGTGACAGTGTCCAATTCCTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCATTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.884 |
100 |
0.725 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
74.648 |
0.451 |
| ssbA | Streptococcus mutans UA159 |
40.141 |
100 |
0.401 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.86 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
38.732 |
100 |
0.387 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
38.732 |
100 |
0.387 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
38.732 |
100 |
0.387 |
| ssbB/cilA | Streptococcus mitis SK321 |
38.732 |
100 |
0.387 |