Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | V6C68_RS09555 | Genome accession | NZ_CP145228 |
| Coordinates | 1967052..1967465 (-) | Length | 137 a.a. |
| NCBI ID | WP_049399325.1 | Uniprot ID | - |
| Organism | Staphylococcus capitis subsp. urealyticus strain Sc1365695 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1930302..1976001 | 1967052..1967465 | within | 0 |
Gene organization within MGE regions
Location: 1930302..1976001
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V6C68_RS09285 (V6C68_09270) | - | 1930302..1930499 (-) | 198 | WP_023350503.1 | hypothetical protein | - |
| V6C68_RS09290 (V6C68_09275) | - | 1931449..1931634 (-) | 186 | WP_023350504.1 | hypothetical protein | - |
| V6C68_RS09295 (V6C68_09280) | - | 1931636..1931746 (-) | 111 | WP_049307399.1 | hypothetical protein | - |
| V6C68_RS09300 (V6C68_09285) | - | 1931817..1931968 (-) | 152 | Protein_1795 | hypothetical protein | - |
| V6C68_RS09305 (V6C68_09290) | - | 1932115..1933578 (-) | 1464 | WP_367027651.1 | SH3 domain-containing protein | - |
| V6C68_RS09310 (V6C68_09295) | - | 1933553..1933963 (-) | 411 | WP_023350506.1 | phage holin | - |
| V6C68_RS09315 (V6C68_09300) | - | 1934008..1934541 (-) | 534 | WP_023350507.1 | hypothetical protein | - |
| V6C68_RS09320 (V6C68_09305) | - | 1934541..1935056 (-) | 516 | WP_023350508.1 | hypothetical protein | - |
| V6C68_RS09325 (V6C68_09310) | - | 1935098..1935244 (-) | 147 | WP_023350509.1 | XkdX family protein | - |
| V6C68_RS09330 (V6C68_09315) | - | 1935237..1935581 (-) | 345 | WP_023350510.1 | hypothetical protein | - |
| V6C68_RS09335 (V6C68_09320) | - | 1935593..1937251 (-) | 1659 | WP_023350511.1 | BppU family phage baseplate upper protein | - |
| V6C68_RS09340 (V6C68_09325) | - | 1937304..1938506 (-) | 1203 | WP_080978319.1 | N-acetylglucosaminidase | - |
| V6C68_RS09345 (V6C68_09330) | - | 1939155..1939391 (-) | 237 | Protein_1804 | CHAP domain-containing protein | - |
| V6C68_RS09350 (V6C68_09335) | - | 1939706..1939837 (-) | 132 | WP_023350514.1 | hypothetical protein | - |
| V6C68_RS09355 (V6C68_09340) | - | 1939891..1940289 (-) | 399 | WP_037560594.1 | hypothetical protein | - |
| V6C68_RS09360 (V6C68_09345) | - | 1940270..1940692 (-) | 423 | WP_023350516.1 | hypothetical protein | - |
| V6C68_RS09365 (V6C68_09350) | - | 1940706..1941893 (-) | 1188 | WP_023350517.1 | BppU family phage baseplate upper protein | - |
| V6C68_RS09370 (V6C68_09355) | - | 1941906..1943780 (-) | 1875 | WP_124778642.1 | M14 family metallopeptidase | - |
| V6C68_RS09375 (V6C68_09360) | - | 1943783..1945243 (-) | 1461 | WP_023350519.1 | phage tail protein | - |
| V6C68_RS09380 (V6C68_09365) | - | 1945255..1946211 (-) | 957 | WP_023350520.1 | phage tail domain-containing protein | - |
| V6C68_RS09385 (V6C68_09370) | - | 1946223..1950152 (-) | 3930 | WP_049399432.1 | tail protein | - |
| V6C68_RS09390 (V6C68_09375) | - | 1950167..1950511 (-) | 345 | WP_023350522.1 | hypothetical protein | - |
| V6C68_RS09395 (V6C68_09380) | - | 1950553..1950912 (-) | 360 | WP_023350523.1 | tail assembly chaperone | - |
| V6C68_RS09400 (V6C68_09385) | - | 1950975..1951529 (-) | 555 | WP_002436441.1 | phage major tail protein, TP901-1 family | - |
| V6C68_RS09405 (V6C68_09390) | - | 1951576..1951965 (-) | 390 | WP_023350524.1 | hypothetical protein | - |
| V6C68_RS09410 (V6C68_09395) | - | 1952259..1952945 (-) | 687 | WP_367027652.1 | hypothetical protein | - |
| V6C68_RS09415 (V6C68_09400) | - | 1953069..1953317 (-) | 249 | Protein_1818 | hypothetical protein | - |
| V6C68_RS09420 (V6C68_09405) | - | 1953317..1953619 (-) | 303 | WP_023350527.1 | hypothetical protein | - |
| V6C68_RS09425 (V6C68_09410) | - | 1953616..1953945 (-) | 330 | WP_002436519.1 | phage head-tail connector protein | - |
| V6C68_RS09430 (V6C68_09415) | - | 1953947..1954216 (-) | 270 | WP_023350528.1 | hypothetical protein | - |
| V6C68_RS09435 (V6C68_09420) | - | 1954239..1955153 (-) | 915 | WP_023350529.1 | phage major capsid protein | - |
| V6C68_RS09440 (V6C68_09425) | - | 1955170..1955784 (-) | 615 | WP_023350530.1 | DUF4355 domain-containing protein | - |
| V6C68_RS09445 (V6C68_09430) | - | 1956037..1956180 (-) | 144 | WP_002436512.1 | hypothetical protein | - |
| V6C68_RS09450 (V6C68_09435) | - | 1956173..1956718 (-) | 546 | WP_023350531.1 | hypothetical protein | - |
| V6C68_RS09455 (V6C68_09440) | - | 1956738..1957688 (-) | 951 | WP_049399435.1 | minor capsid protein | - |
| V6C68_RS09460 (V6C68_09445) | - | 1957695..1959191 (-) | 1497 | Protein_1827 | phage portal protein | - |
| V6C68_RS09465 (V6C68_09450) | - | 1959205..1960497 (-) | 1293 | WP_023350535.1 | PBSX family phage terminase large subunit | - |
| V6C68_RS09470 (V6C68_09455) | - | 1960490..1960831 (-) | 342 | WP_049307394.1 | phBC6A51 family helix-turn-helix protein | - |
| V6C68_RS09475 (V6C68_09460) | - | 1961109..1961525 (-) | 417 | WP_002436508.1 | hypothetical protein | - |
| V6C68_RS09480 (V6C68_09465) | - | 1961596..1961766 (-) | 171 | WP_002469957.1 | hypothetical protein | - |
| V6C68_RS09485 (V6C68_09470) | - | 1961772..1961912 (-) | 141 | WP_002475527.1 | DUF1381 domain-containing protein | - |
| V6C68_RS09490 (V6C68_09475) | - | 1961914..1962090 (-) | 177 | WP_023350538.1 | hypothetical protein | - |
| V6C68_RS09495 (V6C68_09480) | dut | 1962127..1962552 (-) | 426 | WP_049388193.1 | dUTP diphosphatase | - |
| V6C68_RS09500 (V6C68_09485) | - | 1962554..1962751 (-) | 198 | WP_023350541.1 | hypothetical protein | - |
| V6C68_RS09505 (V6C68_09490) | - | 1962735..1963289 (-) | 555 | WP_023350542.1 | nucleoside 2-deoxyribosyltransferase | - |
| V6C68_RS09510 (V6C68_09495) | - | 1963292..1963489 (-) | 198 | WP_023350543.1 | hypothetical protein | - |
| V6C68_RS09515 (V6C68_09500) | - | 1963490..1963837 (-) | 348 | WP_023350544.1 | SA1788 family PVL leukocidin-associated protein | - |
| V6C68_RS09520 (V6C68_09505) | - | 1963838..1964029 (-) | 192 | WP_023350545.1 | hypothetical protein | - |
| V6C68_RS09525 (V6C68_09510) | - | 1964019..1964429 (-) | 411 | WP_367027653.1 | DUF1064 domain-containing protein | - |
| V6C68_RS09530 (V6C68_09515) | - | 1964438..1964683 (-) | 246 | WP_002469995.1 | DUF3269 family protein | - |
| V6C68_RS09535 (V6C68_09520) | - | 1964686..1964841 (-) | 156 | WP_002469952.1 | hypothetical protein | - |
| V6C68_RS09540 (V6C68_09525) | - | 1964835..1965596 (-) | 762 | WP_227707438.1 | ATP-binding protein | - |
| V6C68_RS09545 (V6C68_09530) | - | 1965616..1966371 (-) | 756 | WP_037560596.1 | conserved phage C-terminal domain-containing protein | - |
| V6C68_RS09550 (V6C68_09535) | - | 1966358..1967038 (-) | 681 | WP_023350548.1 | putative HNHc nuclease | - |
| V6C68_RS09555 (V6C68_09540) | ssbA | 1967052..1967465 (-) | 414 | WP_049399325.1 | single-stranded DNA-binding protein | Machinery gene |
| V6C68_RS09560 (V6C68_09545) | - | 1967458..1968111 (-) | 654 | WP_023350550.1 | ERF family protein | - |
| V6C68_RS09565 (V6C68_09550) | - | 1968104..1968325 (-) | 222 | WP_023350551.1 | DUF2483 family protein | - |
| V6C68_RS09570 (V6C68_09555) | - | 1968291..1968572 (-) | 282 | WP_023350552.1 | hypothetical protein | - |
| V6C68_RS09575 (V6C68_09560) | - | 1968594..1968812 (-) | 219 | WP_023350553.1 | hypothetical protein | - |
| V6C68_RS09580 (V6C68_09565) | - | 1969290..1969502 (-) | 213 | WP_002436465.1 | DUF771 domain-containing protein | - |
| V6C68_RS09585 (V6C68_09570) | - | 1969506..1969673 (-) | 168 | WP_023350555.1 | hypothetical protein | - |
| V6C68_RS09590 (V6C68_09575) | - | 1969775..1969969 (-) | 195 | WP_023350556.1 | hypothetical protein | - |
| V6C68_RS09595 (V6C68_09580) | - | 1970052..1970228 (+) | 177 | WP_023350557.1 | hypothetical protein | - |
| V6C68_RS09600 (V6C68_09585) | - | 1970254..1970352 (-) | 99 | Protein_1855 | hypothetical protein | - |
| V6C68_RS09605 (V6C68_09590) | - | 1970442..1970618 (-) | 177 | WP_023350559.1 | hypothetical protein | - |
| V6C68_RS09610 (V6C68_09595) | - | 1970701..1971468 (-) | 768 | WP_160312606.1 | DUF6551 family protein | - |
| V6C68_RS09615 (V6C68_09600) | - | 1971468..1972424 (-) | 957 | WP_049307539.1 | ParB N-terminal domain-containing protein | - |
| V6C68_RS09620 (V6C68_09605) | - | 1972440..1972679 (-) | 240 | WP_049399294.1 | helix-turn-helix transcriptional regulator | - |
| V6C68_RS09625 (V6C68_09610) | - | 1972873..1973202 (+) | 330 | WP_002469947.1 | helix-turn-helix transcriptional regulator | - |
| V6C68_RS09630 (V6C68_09615) | - | 1973214..1973675 (+) | 462 | WP_023350564.1 | ImmA/IrrE family metallo-endopeptidase | - |
| V6C68_RS09635 (V6C68_09620) | - | 1973694..1974218 (+) | 525 | WP_023350565.1 | Ltp family lipoprotein | - |
| V6C68_RS09640 (V6C68_09625) | - | 1974233..1974880 (+) | 648 | WP_023350566.1 | hypothetical protein | - |
| V6C68_RS09645 (V6C68_09630) | - | 1974940..1976001 (+) | 1062 | WP_023350567.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 137 a.a. Molecular weight: 15558.23 Da Isoelectric Point: 8.5209
>NTDB_id=937977 V6C68_RS09555 WP_049399325.1 1967052..1967465(-) (ssbA) [Staphylococcus capitis subsp. urealyticus strain Sc1365695]
MINRFIGVGRLTKDPEFRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQADNVNKFLTKGSLAGVEGRIQTR
SYENNEGRRIFVTKVVCDSVQFLDTKNNNGNNNRQQTEQTQQEKPFDNGNDFPDLPF
MINRFIGVGRLTKDPEFRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQADNVNKFLTKGSLAGVEGRIQTR
SYENNEGRRIFVTKVVCDSVQFLDTKNNNGNNNRQQTEQTQQEKPFDNGNDFPDLPF
Nucleotide
Download Length: 414 bp
>NTDB_id=937977 V6C68_RS09555 WP_049399325.1 1967052..1967465(-) (ssbA) [Staphylococcus capitis subsp. urealyticus strain Sc1365695]
ATGATTAATCGTTTTATAGGTGTAGGAAGATTAACAAAAGATCCAGAATTCAGAACAACGCCAAATGGTGTCAGTGTGAC
AACTTTTACAATCGCAGTGAATAGAACGTTCACTAATGCTCAAGGAGAGCGTGAGGCTGATTTTATTAACTGTGTAACGT
TCAGAAAACAAGCTGATAACGTAAATAAGTTTTTAACAAAAGGGTCACTTGCAGGCGTTGAAGGTCGCATTCAAACGCGT
AGTTACGAAAACAATGAAGGTAGACGCATTTTTGTCACTAAGGTTGTGTGTGATAGCGTTCAGTTTTTAGATACAAAAAA
TAACAACGGAAATAATAACCGACAACAAACAGAACAAACGCAACAAGAGAAACCATTTGATAATGGCAACGATTTTCCTG
ACCTTCCTTTTTAA
ATGATTAATCGTTTTATAGGTGTAGGAAGATTAACAAAAGATCCAGAATTCAGAACAACGCCAAATGGTGTCAGTGTGAC
AACTTTTACAATCGCAGTGAATAGAACGTTCACTAATGCTCAAGGAGAGCGTGAGGCTGATTTTATTAACTGTGTAACGT
TCAGAAAACAAGCTGATAACGTAAATAAGTTTTTAACAAAAGGGTCACTTGCAGGCGTTGAAGGTCGCATTCAAACGCGT
AGTTACGAAAACAATGAAGGTAGACGCATTTTTGTCACTAAGGTTGTGTGTGATAGCGTTCAGTTTTTAGATACAAAAAA
TAACAACGGAAATAATAACCGACAACAAACAGAACAAACGCAACAAGAGAAACCATTTGATAATGGCAACGATTTTCCTG
ACCTTCCTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
71.028 |
78.102 |
0.555 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.547 |
77.372 |
0.445 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.66 |
77.372 |
0.431 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.394 |
96.35 |
0.38 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.394 |
96.35 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
38.636 |
96.35 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
38.636 |
96.35 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
38.636 |
96.35 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
38.636 |
96.35 |
0.372 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.879 |
96.35 |
0.365 |
| ssbA | Streptococcus mutans UA159 |
37.879 |
96.35 |
0.365 |