Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | V3434_RS06145 | Genome accession | NZ_CP144271 |
| Coordinates | 1240395..1240823 (+) | Length | 142 a.a. |
| NCBI ID | WP_016187439.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain LA31 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1229507..1277080 | 1240395..1240823 | within | 0 |
Gene organization within MGE regions
Location: 1229507..1277080
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V3434_RS06030 (V3434_06030) | - | 1229507..1230712 (-) | 1206 | WP_031868073.1 | tyrosine-type recombinase/integrase | - |
| V3434_RS06035 (V3434_06035) | - | 1230771..1232429 (-) | 1659 | WP_001286806.1 | DpnII family type II restriction endonuclease | - |
| V3434_RS06040 (V3434_06040) | - | 1232547..1233467 (-) | 921 | WP_000348133.1 | exonuclease domain-containing protein | - |
| V3434_RS06045 (V3434_06045) | - | 1233483..1234097 (-) | 615 | WP_031867687.1 | XRE family transcriptional regulator | - |
| V3434_RS06050 (V3434_06050) | - | 1234269..1234496 (+) | 228 | WP_001030311.1 | hypothetical protein | - |
| V3434_RS06055 (V3434_06055) | - | 1234522..1235301 (+) | 780 | WP_021285981.1 | phage antirepressor | - |
| V3434_RS06060 (V3434_06060) | - | 1235302..1235526 (+) | 225 | WP_031867688.1 | hypothetical protein | - |
| V3434_RS06065 (V3434_06065) | - | 1235566..1235709 (+) | 144 | WP_000939498.1 | hypothetical protein | - |
| V3434_RS06070 (V3434_06070) | - | 1235699..1235908 (-) | 210 | WP_000642492.1 | hypothetical protein | - |
| V3434_RS06075 (V3434_06075) | - | 1235964..1236113 (+) | 150 | WP_000771849.1 | hypothetical protein | - |
| V3434_RS06080 (V3434_06080) | - | 1236154..1236366 (-) | 213 | WP_000362644.1 | hypothetical protein | - |
| V3434_RS06085 (V3434_06085) | - | 1236436..1236633 (+) | 198 | WP_001148860.1 | hypothetical protein | - |
| V3434_RS06090 (V3434_06090) | - | 1236620..1237000 (-) | 381 | WP_000773059.1 | DUF2513 domain-containing protein | - |
| V3434_RS06095 (V3434_06095) | - | 1237067..1237312 (+) | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| V3434_RS06100 (V3434_06100) | - | 1237281..1237646 (-) | 366 | WP_001128433.1 | hypothetical protein | - |
| V3434_RS06105 (V3434_06105) | - | 1237701..1237916 (+) | 216 | WP_001097552.1 | hypothetical protein | - |
| V3434_RS06110 (V3434_06110) | - | 1237943..1238206 (+) | 264 | WP_001124192.1 | helix-turn-helix domain-containing protein | - |
| V3434_RS06115 (V3434_06115) | - | 1238218..1238379 (+) | 162 | WP_001285948.1 | DUF1270 domain-containing protein | - |
| V3434_RS06120 (V3434_06120) | - | 1238474..1238776 (+) | 303 | WP_031794901.1 | DUF2482 family protein | - |
| V3434_RS06125 (V3434_06125) | - | 1238781..1239041 (+) | 261 | WP_350950531.1 | DUF1108 family protein | - |
| V3434_RS06130 (V3434_06130) | - | 1239049..1239285 (+) | 237 | WP_000848127.1 | hypothetical protein | - |
| V3434_RS06135 (V3434_06135) | - | 1239278..1239757 (+) | 480 | WP_000002512.1 | siphovirus Gp157 family protein | - |
| V3434_RS06140 (V3434_06140) | - | 1239757..1240395 (+) | 639 | WP_001043063.1 | ERF family protein | - |
| V3434_RS06145 (V3434_06145) | ssbA | 1240395..1240823 (+) | 429 | WP_016187439.1 | single-stranded DNA-binding protein | Machinery gene |
| V3434_RS06150 (V3434_06150) | - | 1240837..1241511 (+) | 675 | WP_031867690.1 | putative HNHc nuclease | - |
| V3434_RS06155 (V3434_06155) | - | 1241504..1242259 (+) | 756 | WP_001037657.1 | DnaD domain protein | - |
| V3434_RS06160 (V3434_06160) | - | 1242259..1242615 (+) | 357 | WP_001132247.1 | hypothetical protein | - |
| V3434_RS06165 (V3434_06165) | - | 1242612..1243853 (+) | 1242 | WP_031794787.1 | DnaB helicase C-terminal domain-containing protein | - |
| V3434_RS06170 (V3434_06170) | - | 1243850..1244065 (+) | 216 | WP_031794786.1 | hypothetical protein | - |
| V3434_RS06175 (V3434_06175) | - | 1244068..1244289 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| V3434_RS06180 (V3434_06180) | - | 1244299..1244703 (+) | 405 | WP_000049794.1 | DUF1064 domain-containing protein | - |
| V3434_RS06185 (V3434_06185) | - | 1244708..1244893 (+) | 186 | WP_001187243.1 | DUF3113 family protein | - |
| V3434_RS06190 (V3434_06190) | - | 1244894..1245199 (+) | 306 | WP_000101252.1 | hypothetical protein | - |
| V3434_RS06195 (V3434_06195) | - | 1245327..1245683 (+) | 357 | WP_001557189.1 | SA1788 family PVL leukocidin-associated protein | - |
| V3434_RS06200 (V3434_06200) | - | 1245687..1245929 (+) | 243 | WP_031911972.1 | SAV1978 family virulence-associated passenger protein | - |
| V3434_RS06205 (V3434_06205) | - | 1245943..1246149 (+) | 207 | WP_000693989.1 | hypothetical protein | - |
| V3434_RS06210 (V3434_06210) | - | 1246152..1246559 (+) | 408 | WP_000695771.1 | hypothetical protein | - |
| V3434_RS06215 (V3434_06215) | - | 1246556..1246750 (+) | 195 | WP_000983950.1 | hypothetical protein | - |
| V3434_RS06220 (V3434_06220) | - | 1246747..1247184 (+) | 438 | WP_000982714.1 | YopX family protein | - |
| V3434_RS06225 (V3434_06225) | - | 1247181..1247546 (+) | 366 | WP_001105602.1 | hypothetical protein | - |
| V3434_RS06230 (V3434_06230) | - | 1247539..1247787 (+) | 249 | WP_031795590.1 | DUF1024 family protein | - |
| V3434_RS06235 (V3434_06235) | - | 1247780..1248316 (+) | 537 | WP_000185680.1 | dUTPase | - |
| V3434_RS06240 (V3434_06240) | - | 1248353..1248559 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| V3434_RS06245 (V3434_06245) | - | 1248556..1248939 (+) | 384 | WP_031795332.1 | phage protein | - |
| V3434_RS06250 (V3434_06250) | - | 1248939..1249091 (+) | 153 | WP_031795333.1 | transcriptional regulator | - |
| V3434_RS06255 (V3434_06255) | - | 1249159..1249359 (+) | 201 | WP_031795334.1 | DUF1514 family protein | - |
| V3434_RS06260 (V3434_06260) | - | 1249343..1249663 (+) | 321 | Protein_1230 | ATP-dependent helicase | - |
| V3434_RS06265 (V3434_06265) | - | 1249676..1250113 (+) | 438 | WP_000513702.1 | transcriptional regulator | - |
| V3434_RS06270 (V3434_06270) | - | 1250270..1250584 (+) | 315 | WP_000160693.1 | HNH endonuclease | - |
| V3434_RS06275 (V3434_06275) | - | 1250712..1251017 (+) | 306 | WP_000778933.1 | P27 family phage terminase small subunit | - |
| V3434_RS06280 (V3434_06280) | - | 1251007..1252698 (+) | 1692 | WP_031824234.1 | terminase TerL endonuclease subunit | - |
| V3434_RS06285 (V3434_06285) | - | 1252703..1253941 (+) | 1239 | WP_001100659.1 | phage portal protein | - |
| V3434_RS06290 (V3434_06290) | - | 1253925..1254704 (+) | 780 | WP_350950552.1 | head maturation protease, ClpP-related | - |
| V3434_RS06295 (V3434_06295) | - | 1254688..1255860 (-) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| V3434_RS06300 (V3434_06300) | - | 1256042..1257205 (+) | 1164 | WP_031776039.1 | phage major capsid protein | - |
| V3434_RS06305 (V3434_06305) | - | 1257274..1257552 (+) | 279 | WP_000050973.1 | head-tail connector protein | - |
| V3434_RS06310 (V3434_06310) | - | 1257564..1257896 (+) | 333 | WP_000395498.1 | hypothetical protein | - |
| V3434_RS06315 (V3434_06315) | - | 1257893..1258294 (+) | 402 | WP_000110017.1 | hypothetical protein | - |
| V3434_RS06320 (V3434_06320) | - | 1258295..1258690 (+) | 396 | WP_031775786.1 | DUF3168 domain-containing protein | - |
| V3434_RS06325 (V3434_06325) | - | 1258725..1259366 (+) | 642 | WP_000807536.1 | major tail protein | - |
| V3434_RS06330 (V3434_06330) | - | 1259458..1259913 (+) | 456 | WP_031775895.1 | Ig-like domain-containing protein | - |
| V3434_RS06335 (V3434_06335) | - | 1259971..1260321 (+) | 351 | WP_000589165.1 | hypothetical protein | - |
| V3434_RS06340 (V3434_06340) | - | 1260363..1260521 (+) | 159 | WP_000438833.1 | hypothetical protein | - |
| V3434_RS06345 (V3434_06345) | - | 1260535..1266735 (+) | 6201 | WP_031795004.1 | phage tail tape measure protein | - |
| V3434_RS06350 (V3434_06350) | - | 1266735..1267559 (+) | 825 | WP_031775783.1 | phage tail family protein | - |
| V3434_RS06355 (V3434_06355) | - | 1267568..1269151 (+) | 1584 | WP_031795005.1 | prophage endopeptidase tail family protein | - |
| V3434_RS06360 (V3434_06360) | - | 1269151..1269441 (+) | 291 | WP_000179860.1 | hypothetical protein | - |
| V3434_RS06365 (V3434_06365) | - | 1269457..1271367 (+) | 1911 | WP_031795006.1 | hypothetical protein | - |
| V3434_RS06370 (V3434_06370) | - | 1271367..1272833 (+) | 1467 | WP_031795007.1 | BppU family phage baseplate upper protein | - |
| V3434_RS06375 (V3434_06375) | - | 1272833..1273222 (+) | 390 | WP_001166606.1 | DUF2977 domain-containing protein | - |
| V3434_RS06380 (V3434_06380) | - | 1273215..1273379 (+) | 165 | WP_016187456.1 | XkdX family protein | - |
| V3434_RS06385 (V3434_06385) | - | 1273425..1273724 (+) | 300 | WP_000466775.1 | DUF2951 family protein | - |
| V3434_RS06390 (V3434_06390) | - | 1273860..1274162 (+) | 303 | WP_000339142.1 | phage holin | - |
| V3434_RS06395 (V3434_06395) | - | 1274174..1275628 (+) | 1455 | WP_000930261.1 | N-acetylmuramoyl-L-alanine amidase | - |
| V3434_RS06400 (V3434_06400) | - | 1276244..1277080 (+) | 837 | WP_000675478.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16066.57 Da Isoelectric Point: 5.8724
>NTDB_id=933149 V3434_RS06145 WP_016187439.1 1240395..1240823(+) (ssbA) [Staphylococcus aureus strain LA31]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=933149 V3434_RS06145 WP_016187439.1 1240395..1240823(+) (ssbA) [Staphylococcus aureus strain LA31]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACCTCCCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.62 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.401 |