Detailed information NTG0093163

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: MWM01_RS17930
• Genome accession: NZ_AP025623
• Coordinates: 3547995..3548342 (-)
• Length: 115 a.a.
• NCBI ID: WP_244404488.1
• Uniprot ID: -
• Organism: Saccharococcus caldoxylosilyticus strain KH1-5
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	3531499..3548342	3547995..3548342	within	0

Gene organization within MGE regions

Location: 3531499..3548342

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MWM01_RS17880 (PcaKH15_34700)	-	3531499..3533382 (-)	1884	WP_244380361.1	S-layer homology domain-containing protein	-
MWM01_RS17885 (PcaKH15_34710)	-	3533662..3534666 (-)	1005	WP_244404485.1	C40 family peptidase	-
MWM01_RS17890 (PcaKH15_34720)	-	3534879..3538544 (+)	3666	WP_244404486.1	S8 family peptidase	-
MWM01_RS17895 (PcaKH15_34730)	-	3538586..3540505 (-)	1920	WP_244380365.1	S8 family serine peptidase	-
MWM01_RS17900 (PcaKH15_34740)	-	3540585..3541991 (-)	1407	WP_244380366.1	N-acetylmuramoyl-L-alanine amidase	-
MWM01_RS17905 (PcaKH15_34750)	-	3542825..3543142 (-)	318	WP_244380368.1	hypothetical protein	-
MWM01_RS17910 (PcaKH15_34760)	wecB	3543325..3544470 (-)	1146	WP_244380370.1	non-hydrolyzing UDP-N-acetylglucosamine 2-epimerase	-
MWM01_RS17915 (PcaKH15_34770)	-	3544885..3546249 (-)	1365	WP_409993714.1	peptidoglycan-binding protein	-
MWM01_RS17920 (PcaKH15_34780)	-	3546699..3547199 (-)	501	WP_244380374.1	hypothetical protein	-
MWM01_RS17925 (PcaKH15_34790)	-	3547410..3547821 (+)	412	Protein_3506	helix-turn-helix domain-containing protein	-
MWM01_RS17930 (PcaKH15_34800)	ssbB	3547995..3548342 (-)	348	WP_244404488.1	single-stranded DNA-binding protein	Machinery gene

Sequence

Protein

• Length: 115 a.a.
• Molecular weight: 13013.79 Da
• Isoelectric Point: 9.0791

>NTDB_id=93163 MWM01_RS17930 WP_244404488.1 3547995..3548342(-) (ssbB) [Saccharococcus caldoxylosilyticus strain KH1-5]
MINQVVLVGRLTKDLELRYTADGAAVANITLAVARNFRNVEGRVDTDFVPCVLWRKTAENTANYCRKGSMIAVTGRVQTR
NYENKDGQRVYVTEVVAESVRFISTSKVNEWFEHA

Nucleotide

• Length: 348 bp

>NTDB_id=93163 MWM01_RS17930 WP_244404488.1 3547995..3548342(-) (ssbB) [Saccharococcus caldoxylosilyticus strain KH1-5]
ATGATTAATCAAGTGGTGCTCGTCGGCCGGTTAACGAAAGATCTGGAACTTCGCTATACCGCCGATGGAGCAGCAGTCGC
TAACATTACGTTAGCAGTAGCAAGAAATTTCCGCAATGTAGAAGGGAGGGTAGATACTGATTTCGTCCCGTGCGTCCTTT
GGCGAAAGACAGCAGAAAACACGGCCAATTATTGCCGAAAAGGCTCGATGATTGCGGTGACGGGACGGGTCCAAACGCGA
AACTATGAAAACAAAGACGGACAGCGTGTCTATGTCACTGAGGTAGTAGCGGAATCTGTCCGCTTTATCAGCACCAGCAA
AGTGAATGAATGGTTCGAGCATGCCTGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-102)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Bacillus subtilis subsp. subtilis str. 168	65.049	89.565	0.583
ssbA	Bacillus subtilis subsp. subtilis str. 168	65.049	89.565	0.583
ssb	Latilactobacillus sakei subsp. sakei 23K	56.364	95.652	0.539
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.81	91.304	0.4
ssbB/cilA	Streptococcus mitis NCTC 12261	42.857	91.304	0.391
ssbB/cilA	Streptococcus pneumoniae TIGR4	42.857	91.304	0.391
ssbA	Streptococcus mutans UA159	41.905	91.304	0.383
ssbB/cilA	Streptococcus pneumoniae Rx1	41.905	91.304	0.383
ssbB/cilA	Streptococcus pneumoniae D39	41.905	91.304	0.383
ssbB/cilA	Streptococcus pneumoniae R6	41.905	91.304	0.383
ssbB/cilA	Streptococcus mitis SK321	41.905	91.304	0.383