Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | VNN27_RS10085 | Genome accession | NZ_CP141700 |
| Coordinates | 2074425..2074841 (-) | Length | 138 a.a. |
| NCBI ID | WP_346350003.1 | Uniprot ID | - |
| Organism | Lactococcus petauri strain R22-25 IC35 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2042497..2082133 | 2074425..2074841 | within | 0 |
Gene organization within MGE regions
Location: 2042497..2082133
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VNN27_RS09860 (VNN27_09860) | - | 2042497..2042670 (-) | 174 | WP_276414265.1 | hypothetical protein | - |
| VNN27_RS09870 (VNN27_09870) | - | 2043764..2044570 (-) | 807 | WP_019293170.1 | DUF1828 domain-containing protein | - |
| VNN27_RS09875 (VNN27_09875) | - | 2044574..2045038 (-) | 465 | WP_346349973.1 | hypothetical protein | - |
| VNN27_RS09880 (VNN27_09880) | - | 2045297..2045611 (+) | 315 | WP_346349974.1 | hypothetical protein | - |
| VNN27_RS09885 (VNN27_09885) | - | 2045669..2046079 (-) | 411 | WP_346349975.1 | hypothetical protein | - |
| VNN27_RS09890 (VNN27_09890) | - | 2046276..2046470 (-) | 195 | WP_346349976.1 | hypothetical protein | - |
| VNN27_RS09895 (VNN27_09895) | - | 2046945..2047127 (+) | 183 | WP_346349977.1 | hypothetical protein | - |
| VNN27_RS09900 (VNN27_09900) | - | 2047254..2047544 (-) | 291 | WP_346349978.1 | YjcQ family protein | - |
| VNN27_RS09905 (VNN27_09905) | - | 2047816..2048181 (-) | 366 | WP_285122058.1 | hypothetical protein | - |
| VNN27_RS09910 (VNN27_09910) | - | 2048310..2048867 (-) | 558 | WP_285122057.1 | hypothetical protein | - |
| VNN27_RS09915 (VNN27_09915) | - | 2048951..2050012 (-) | 1062 | WP_346349979.1 | LysM peptidoglycan-binding domain-containing protein | - |
| VNN27_RS09920 (VNN27_09920) | - | 2049996..2050358 (-) | 363 | WP_019299702.1 | hypothetical protein | - |
| VNN27_RS09925 (VNN27_09925) | - | 2050376..2050780 (-) | 405 | WP_249663278.1 | hypothetical protein | - |
| VNN27_RS09930 (VNN27_09930) | - | 2050792..2051667 (-) | 876 | WP_346349980.1 | carbohydrate binding domain-containing protein | - |
| VNN27_RS09935 (VNN27_09935) | - | 2051671..2052615 (-) | 945 | WP_346349981.1 | BppU family phage baseplate upper protein | - |
| VNN27_RS09940 (VNN27_09940) | - | 2052631..2054331 (-) | 1701 | WP_346350230.1 | phage tail tip lysozyme | - |
| VNN27_RS09945 (VNN27_09945) | - | 2054431..2055465 (-) | 1035 | Protein_1911 | phage tail spike protein | - |
| VNN27_RS09950 (VNN27_09950) | - | 2055465..2056226 (-) | 762 | WP_346349982.1 | distal tail protein Dit | - |
| VNN27_RS09955 (VNN27_09955) | - | 2056235..2058586 (-) | 2352 | WP_346349983.1 | tape measure protein | - |
| VNN27_RS09960 (VNN27_09960) | - | 2058600..2058860 (-) | 261 | WP_279364706.1 | hypothetical protein | - |
| VNN27_RS09965 (VNN27_09965) | - | 2058947..2059294 (-) | 348 | WP_346349984.1 | tail assembly chaperone | - |
| VNN27_RS09970 (VNN27_09970) | - | 2059343..2059873 (-) | 531 | WP_274978398.1 | phage major tail protein, TP901-1 family | - |
| VNN27_RS09975 (VNN27_09975) | - | 2059883..2060272 (-) | 390 | WP_346349985.1 | phage capsid protein | - |
| VNN27_RS09980 (VNN27_09980) | - | 2060269..2060595 (-) | 327 | WP_346349986.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| VNN27_RS09985 (VNN27_09985) | - | 2060592..2060903 (-) | 312 | WP_276414278.1 | hypothetical protein | - |
| VNN27_RS09990 (VNN27_09990) | - | 2060900..2061232 (-) | 333 | WP_346349987.1 | phage head-tail connector protein | - |
| VNN27_RS09995 (VNN27_09995) | - | 2061243..2061482 (-) | 240 | WP_346349988.1 | Ig-like domain-containing protein | - |
| VNN27_RS10000 (VNN27_10000) | - | 2061500..2062324 (-) | 825 | WP_346349989.1 | N4-gp56 family major capsid protein | - |
| VNN27_RS10005 (VNN27_10005) | - | 2062324..2063004 (-) | 681 | WP_346349990.1 | DUF4355 domain-containing protein | - |
| VNN27_RS10010 (VNN27_10010) | - | 2063134..2064165 (-) | 1032 | WP_346349991.1 | minor capsid protein | - |
| VNN27_RS10015 (VNN27_10015) | - | 2064169..2065512 (-) | 1344 | WP_346349992.1 | phage portal protein | - |
| VNN27_RS10020 (VNN27_10020) | - | 2065513..2066733 (-) | 1221 | WP_346349993.1 | PBSX family phage terminase large subunit | - |
| VNN27_RS10025 (VNN27_10025) | - | 2066726..2067235 (-) | 510 | WP_346349994.1 | terminase small subunit | - |
| VNN27_RS10030 (VNN27_10030) | - | 2067369..2068055 (-) | 687 | WP_346349995.1 | CHAP domain-containing protein | - |
| VNN27_RS10035 (VNN27_10035) | - | 2068204..2069499 (-) | 1296 | WP_346349996.1 | hypothetical protein | - |
| VNN27_RS10040 (VNN27_10040) | - | 2069526..2070620 (-) | 1095 | WP_346349997.1 | hypothetical protein | - |
| VNN27_RS10045 (VNN27_10045) | - | 2071026..2071427 (-) | 402 | WP_249663255.1 | DUF722 domain-containing protein | - |
| VNN27_RS10050 (VNN27_10050) | - | 2071618..2072016 (+) | 399 | WP_346349998.1 | Spx/MgsR family RNA polymerase-binding regulatory protein | - |
| VNN27_RS10055 (VNN27_10055) | - | 2072082..2072363 (-) | 282 | WP_346349999.1 | hypothetical protein | - |
| VNN27_RS10060 (VNN27_10060) | - | 2072471..2072875 (-) | 405 | WP_346350000.1 | RusA family crossover junction endodeoxyribonuclease | - |
| VNN27_RS10065 (VNN27_10065) | - | 2072872..2073156 (-) | 285 | WP_276421239.1 | hypothetical protein | - |
| VNN27_RS10070 (VNN27_10070) | - | 2073140..2073928 (-) | 789 | WP_346350001.1 | helix-turn-helix domain-containing protein | - |
| VNN27_RS10075 (VNN27_10075) | - | 2073931..2074095 (-) | 165 | WP_249663249.1 | hypothetical protein | - |
| VNN27_RS10080 (VNN27_10080) | - | 2074095..2074325 (-) | 231 | WP_346350002.1 | helix-turn-helix domain-containing protein | - |
| VNN27_RS10085 (VNN27_10085) | ssb | 2074425..2074841 (-) | 417 | WP_346350003.1 | single-stranded DNA-binding protein | Machinery gene |
| VNN27_RS10090 (VNN27_10090) | - | 2074831..2075511 (-) | 681 | WP_346350004.1 | DUF1071 domain-containing protein | - |
| VNN27_RS10095 (VNN27_10095) | - | 2075523..2075921 (-) | 399 | WP_346350005.1 | hypothetical protein | - |
| VNN27_RS10100 (VNN27_10100) | - | 2076087..2076650 (+) | 564 | WP_346350006.1 | hypothetical protein | - |
| VNN27_RS10105 (VNN27_10105) | - | 2076740..2076889 (-) | 150 | WP_019292873.1 | hypothetical protein | - |
| VNN27_RS10110 (VNN27_10110) | - | 2076906..2077157 (-) | 252 | WP_270745004.1 | hypothetical protein | - |
| VNN27_RS10115 (VNN27_10115) | - | 2077170..2077400 (-) | 231 | WP_153924777.1 | hypothetical protein | - |
| VNN27_RS10120 (VNN27_10120) | - | 2077556..2078011 (+) | 456 | WP_346350007.1 | alkylphosphonate ABC transporter permease | - |
| VNN27_RS10125 (VNN27_10125) | - | 2078407..2078751 (+) | 345 | WP_019292507.1 | XRE family transcriptional regulator | - |
| VNN27_RS10130 (VNN27_10130) | - | 2078763..2079353 (+) | 591 | WP_346350008.1 | hypothetical protein | - |
| VNN27_RS10135 (VNN27_10135) | - | 2079401..2080468 (+) | 1068 | WP_346350009.1 | hypothetical protein | - |
| VNN27_RS10140 (VNN27_10140) | - | 2080511..2080885 (+) | 375 | WP_014572153.1 | PH domain-containing protein | - |
| VNN27_RS10145 (VNN27_10145) | - | 2081009..2082133 (+) | 1125 | WP_346350010.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15586.51 Da Isoelectric Point: 6.3836
>NTDB_id=918514 VNN27_RS10085 WP_346350003.1 2074425..2074841(-) (ssb) [Lactococcus petauri strain R22-25 IC35]
MINNVVLVGRIVRDPELRYTSQNTAVATFTLAVNRRFKNAQGEREADFINCVIWRQPAENLANWAKKGTLVGITGSIQVR
NYENKEGQRVYVTEVLADNFQMLESNSNKTEKGKTKSNQDKDLFAGSPMEVSDDDLPF
MINNVVLVGRIVRDPELRYTSQNTAVATFTLAVNRRFKNAQGEREADFINCVIWRQPAENLANWAKKGTLVGITGSIQVR
NYENKEGQRVYVTEVLADNFQMLESNSNKTEKGKTKSNQDKDLFAGSPMEVSDDDLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=918514 VNN27_RS10085 WP_346350003.1 2074425..2074841(-) (ssb) [Lactococcus petauri strain R22-25 IC35]
ATGATAAATAATGTTGTGTTGGTTGGACGTATTGTCCGTGATCCAGAATTAAGATATACGTCACAGAATACTGCAGTAGC
TACTTTCACTTTAGCAGTAAATCGCCGTTTTAAAAATGCTCAGGGTGAACGAGAAGCAGATTTTATAAACTGTGTTATCT
GGAGACAGCCCGCTGAAAACTTAGCAAATTGGGCAAAAAAAGGTACTTTAGTTGGTATTACTGGAAGTATTCAAGTGAGA
AATTATGAGAACAAGGAAGGTCAACGTGTTTATGTAACAGAAGTATTGGCTGATAACTTTCAAATGCTAGAAAGTAATTC
AAATAAAACAGAAAAAGGGAAAACAAAATCTAATCAAGATAAAGATCTTTTTGCAGGTTCACCAATGGAAGTCTCAGATG
ATGATTTACCATTCTAA
ATGATAAATAATGTTGTGTTGGTTGGACGTATTGTCCGTGATCCAGAATTAAGATATACGTCACAGAATACTGCAGTAGC
TACTTTCACTTTAGCAGTAAATCGCCGTTTTAAAAATGCTCAGGGTGAACGAGAAGCAGATTTTATAAACTGTGTTATCT
GGAGACAGCCCGCTGAAAACTTAGCAAATTGGGCAAAAAAAGGTACTTTAGTTGGTATTACTGGAAGTATTCAAGTGAGA
AATTATGAGAACAAGGAAGGTCAACGTGTTTATGTAACAGAAGTATTGGCTGATAACTTTCAAATGCTAGAAAGTAATTC
AAATAAAACAGAAAAAGGGAAAACAAAATCTAATCAAGATAAAGATCTTTTTGCAGGTTCACCAATGGAAGTCTCAGATG
ATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.645 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50 |
100 |
0.623 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.577 |
75.362 |
0.457 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.928 |
100 |
0.449 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.478 |
100 |
0.435 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.754 |
100 |
0.428 |
| ssbA | Streptococcus mutans UA159 |
40.58 |
100 |
0.406 |