NTDB

Overview

Name	ssbB/cilA	Type	Machinery gene
Locus tag	U0450_RS07025	Genome accession	NZ_CP139863
Coordinates	1382582..1382977 (+)	Length	131 a.a.
NCBI ID	WP_000282467.1	Uniprot ID	A0A098Z0L0
Organism	Streptococcus pneumoniae strain 15P2112
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 1377582..1387977

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
U0450_RS06975	-	1377708..1378070 (+)	363	WP_000078805.1	DUF2200 domain-containing protein	-
U0450_RS06980	-	1378067..1378570 (+)	504	WP_001861715.1	phosphatase PAP2 family protein	-
U0450_RS06985	-	1378684..1379130 (+)	447	WP_000776596.1	LytTR family DNA-binding domain-containing protein	-
U0450_RS06990	-	1379135..1379809 (+)	675	WP_322396491.1	LiaF transmembrane domain-containing protein	-
U0450_RS06995	-	1379970..1380161 (+)	192	WP_000291826.1	cell wall-binding protein	-
U0450_RS07000	-	1380168..1380248 (+)	81	WP_223200442.1	hypothetical protein	-
U0450_RS07005	-	1380446..1380745 (+)	300	WP_001013974.1	DUF4651 domain-containing protein	-
U0450_RS07010	-	1380742..1381059 (+)	318	WP_000615772.1	thioredoxin family protein	-
U0450_RS07015	ytpR	1381075..1381701 (+)	627	WP_322396492.1	YtpR family tRNA-binding protein	-
U0450_RS07020	-	1381743..1382504 (+)	762	WP_001107757.1	SDR family oxidoreductase	-
U0450_RS07025	ssbB/cilA	1382582..1382977 (+)	396	WP_000282467.1	single-stranded DNA-binding protein	Machinery gene
U0450_RS07030	groES	1383247..1383531 (+)	285	WP_000917339.1	co-chaperone GroES	-
U0450_RS07035	groL	1383547..1385169 (+)	1623	WP_000031573.1	chaperonin GroEL	-
U0450_RS07040	-	1385307..1386062 (+)	756	Protein_1362	epoxyqueuosine reductase QueH	-
U0450_RS07045	-	1386508..1387281 (+)	774	WP_044792121.1	class I SAM-dependent methyltransferase	-
U0450_RS07050	-	1387294..1387632 (+)	339	WP_001809290.1	helix-turn-helix transcriptional regulator	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14925.89 Da Isoelectric Point: 5.9409

                                >NTDB_id=911586 U0450_RS07025 WP_000282467.1 1382582..1382977(+) (ssbB/cilA) [Streptococcus pneumoniae strain 15P2112]

MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR

RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=911586 U0450_RS07025 WP_000282467.1 1382582..1382977(+) (ssbB/cilA) [Streptococcus pneumoniae strain 15P2112]

ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC

GCGAGCAACTATCGCTGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTCAATATGGTCCTAT

GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT

CGCTTTGAGAAAAATGGCCAAATGAACTACGTGACCGAAGTACTTGTAACAGGATTCCAACTCTTGGAAAGTCGTGCTCA

ACGTGCCATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTAGTCTTGGAAGAGGAAGAATTGCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-101)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A098Z0L0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB/cilA	Streptococcus pneumoniae D39	100	100	1
ssbB/cilA	Streptococcus pneumoniae Rx1	100	100	1
ssbB/cilA	Streptococcus pneumoniae R6	100	100	1
ssbB/cilA	Streptococcus pneumoniae TIGR4	99.237	100	0.992
ssbB/cilA	Streptococcus mitis SK321	98.473	100	0.985
ssbB/cilA	Streptococcus mitis NCTC 12261	98.473	100	0.985
ssbA	Streptococcus mutans UA159	74.809	100	0.748
ssbB	Streptococcus sobrinus strain NIDR 6715-7	70.229	100	0.702
ssbB	Lactococcus lactis subsp. cremoris KW2	59.821	85.496	0.511
ssbA	Bacillus subtilis subsp. subtilis str. 168	50.943	80.916	0.412
ssb	Latilactobacillus sakei subsp. sakei 23K	46.903	86.26	0.405

Detailed information NTG0911586