NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	SGW56_RS02335	Genome accession	NZ_CP138663
Coordinates	436619..436930 (+)	Length	103 a.a.
NCBI ID	WP_000472255.1	Uniprot ID	A0A0U1MLR1
Organism	Staphylococcus aureus strain DA70518
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 431619..441930

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SGW56_RS02305	-	432402..432605 (+)	204	WP_000087561.1	YqgQ family protein	-
SGW56_RS02310	-	432602..433588 (+)	987	WP_000161307.1	ROK family glucokinase	-
SGW56_RS02315	-	433588..433917 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
SGW56_RS02320	-	433914..434537 (+)	624	WP_001223009.1	MBL fold metallo-hydrolase	-
SGW56_RS02325	comGA	434589..435563 (+)	975	WP_338447636.1	competence type IV pilus ATPase ComGA	Machinery gene
SGW56_RS02330	comGB	435535..436605 (+)	1071	WP_000776409.1	competence type IV pilus assembly protein ComGB	Machinery gene
SGW56_RS02335	comGC	436619..436930 (+)	312	WP_000472255.1	competence type IV pilus major pilin ComGC	Machinery gene
SGW56_RS02340	comGD	436908..437354 (+)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
SGW56_RS02345	comGE	437341..437640 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
SGW56_RS02350	comGF	437558..438055 (+)	498	WP_001796472.1	competence type IV pilus minor pilin ComGF	Machinery gene
SGW56_RS02355	-	438152..438298 (+)	147	WP_001789879.1	hypothetical protein	-
SGW56_RS02360	-	438288..438812 (+)	525	WP_001015120.1	shikimate kinase	-
SGW56_RS02365	gcvT	438971..440062 (+)	1092	WP_000093344.1	glycine cleavage system aminomethyltransferase GcvT	-
SGW56_RS02370	gcvPA	440082..441428 (+)	1347	WP_000019698.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11301.33 Da Isoelectric Point: 8.5268

                                >NTDB_id=904250 SGW56_RS02335 WP_000472255.1 436619..436930(+) (comGC) [Staphylococcus aureus strain DA70518]

MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI

KEAQKTCKSGESITISNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=904250 SGW56_RS02335 WP_000472255.1 436619..436930(+) (comGC) [Staphylococcus aureus strain DA70518]

ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT

AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA

ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA

AAAGAAGCACAAAAGACATGTAAATCAGGAGAGTCAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0U1MLR1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369

Detailed information NTG0904250