Detailed information NTG0903483

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: SHN03_RS07735
• Genome accession: NZ_CP138566
• Coordinates: 1623370..1623681 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472255.1
• Uniprot ID: A0A0U1MLR1
• Organism: Staphylococcus aureus strain AUSMDU00020487
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1618370..1628681

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SHN03_RS07700	gcvPA	1618872..1620218 (-)	1347	WP_000019698.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
SHN03_RS07705	gcvT	1620238..1621329 (-)	1092	WP_000093344.1	glycine cleavage system aminomethyltransferase GcvT	-
SHN03_RS07710	-	1621488..1622012 (-)	525	WP_001015120.1	shikimate kinase	-
SHN03_RS07715	-	1622002..1622148 (-)	147	WP_001789879.1	hypothetical protein	-
SHN03_RS07720	comGF	1622245..1622742 (-)	498	WP_001796472.1	competence type IV pilus minor pilin ComGF	Machinery gene
SHN03_RS07725	comGE	1622660..1622959 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
SHN03_RS07730	comGD	1622946..1623392 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
SHN03_RS07735	comGC	1623370..1623681 (-)	312	WP_000472255.1	competence type IV pilus major pilin ComGC	Machinery gene
SHN03_RS07740	comGB	1623695..1624765 (-)	1071	WP_000776409.1	competence type IV pilus assembly protein ComGB	Machinery gene
SHN03_RS07745	comGA	1624737..1625711 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
SHN03_RS07750	-	1625763..1626386 (-)	624	WP_001223009.1	MBL fold metallo-hydrolase	-
SHN03_RS07755	-	1626383..1626712 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
SHN03_RS07760	-	1626712..1627698 (-)	987	WP_000161307.1	ROK family glucokinase	-
SHN03_RS07765	-	1627695..1627898 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11301.33 Da
• Isoelectric Point: 8.5268

>NTDB_id=903483 SHN03_RS07735 WP_000472255.1 1623370..1623681(-) (comGC) [Staphylococcus aureus strain AUSMDU00020487]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGESITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=903483 SHN03_RS07735 WP_000472255.1 1623370..1623681(-) (comGC) [Staphylococcus aureus strain AUSMDU00020487]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGTCAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A0U1MLR1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369