Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | SGW11_RS04905 | Genome accession | NZ_CP138508 |
| Coordinates | 1022417..1022842 (+) | Length | 141 a.a. |
| NCBI ID | WP_317059629.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain IAF6519 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1012641..1059961 | 1022417..1022842 | within | 0 |
Gene organization within MGE regions
Location: 1012641..1059961
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGW11_RS04830 (SGW11_04830) | - | 1012641..1013330 (-) | 690 | WP_008842223.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| SGW11_RS04835 (SGW11_04835) | - | 1013726..1014805 (-) | 1080 | WP_317059623.1 | tyrosine-type recombinase/integrase | - |
| SGW11_RS04840 (SGW11_04840) | - | 1014943..1015968 (-) | 1026 | WP_317059624.1 | Abi family protein | - |
| SGW11_RS04845 (SGW11_04845) | - | 1016480..1016677 (-) | 198 | WP_204201417.1 | hypothetical protein | - |
| SGW11_RS04850 (SGW11_04850) | - | 1016828..1017724 (-) | 897 | WP_317059625.1 | DUF5067 domain-containing protein | - |
| SGW11_RS04855 (SGW11_04855) | - | 1017743..1018303 (-) | 561 | WP_317059626.1 | hypothetical protein | - |
| SGW11_RS04860 (SGW11_04860) | - | 1018328..1019125 (-) | 798 | WP_323051940.1 | XRE family transcriptional regulator | - |
| SGW11_RS04865 (SGW11_04865) | - | 1019382..1019591 (+) | 210 | WP_065124225.1 | multiprotein-bridging factor 1 family protein | - |
| SGW11_RS04870 (SGW11_04870) | - | 1019605..1020339 (+) | 735 | Protein_930 | Rha family transcriptional regulator | - |
| SGW11_RS04875 (SGW11_04875) | - | 1020408..1020614 (+) | 207 | WP_070366337.1 | helix-turn-helix transcriptional regulator | - |
| SGW11_RS04880 (SGW11_04880) | - | 1020711..1020932 (+) | 222 | WP_193223205.1 | hypothetical protein | - |
| SGW11_RS04885 (SGW11_04885) | - | 1020929..1021210 (-) | 282 | WP_002830747.1 | hypothetical protein | - |
| SGW11_RS04890 (SGW11_04890) | - | 1021358..1021570 (+) | 213 | WP_317059628.1 | hypothetical protein | - |
| SGW11_RS04895 (SGW11_04895) | - | 1021580..1022215 (+) | 636 | WP_159206441.1 | ERF family protein | - |
| SGW11_RS04900 (SGW11_04900) | - | 1022218..1022424 (+) | 207 | WP_159206442.1 | hypothetical protein | - |
| SGW11_RS04905 (SGW11_04905) | ssb | 1022417..1022842 (+) | 426 | WP_317059629.1 | single-stranded DNA-binding protein | Machinery gene |
| SGW11_RS04910 (SGW11_04910) | - | 1022854..1023552 (+) | 699 | WP_317059630.1 | putative HNHc nuclease | - |
| SGW11_RS04915 (SGW11_04915) | - | 1023533..1024285 (+) | 753 | WP_058121223.1 | conserved phage C-terminal domain-containing protein | - |
| SGW11_RS04920 (SGW11_04920) | - | 1024266..1025081 (+) | 816 | WP_058121222.1 | ATP-binding protein | - |
| SGW11_RS04925 (SGW11_04925) | - | 1025199..1025831 (+) | 633 | WP_058121221.1 | hypothetical protein | - |
| SGW11_RS04930 (SGW11_04930) | - | 1025812..1026213 (+) | 402 | WP_204229941.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SGW11_RS04935 (SGW11_04935) | - | 1026210..1026359 (+) | 150 | WP_317059631.1 | hypothetical protein | - |
| SGW11_RS04940 (SGW11_04940) | - | 1026346..1026717 (+) | 372 | WP_317059632.1 | N-acetylmuramoyl-L-alanine amidase | - |
| SGW11_RS04945 (SGW11_04945) | - | 1026886..1027434 (+) | 549 | WP_317059633.1 | DUF1642 domain-containing protein | - |
| SGW11_RS04950 (SGW11_04950) | - | 1027427..1027735 (+) | 309 | WP_317059634.1 | hypothetical protein | - |
| SGW11_RS04955 (SGW11_04955) | - | 1027735..1027983 (+) | 249 | WP_317059635.1 | hypothetical protein | - |
| SGW11_RS04960 (SGW11_04960) | - | 1028170..1028358 (+) | 189 | WP_036672512.1 | hypothetical protein | - |
| SGW11_RS04965 (SGW11_04965) | - | 1028559..1029020 (+) | 462 | WP_002830416.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SGW11_RS04970 (SGW11_04970) | - | 1029194..1029826 (+) | 633 | WP_138492700.1 | hypothetical protein | - |
| SGW11_RS04975 (SGW11_04975) | - | 1029897..1030388 (+) | 492 | WP_317059636.1 | terminase small subunit | - |
| SGW11_RS04980 (SGW11_04980) | - | 1030381..1031727 (+) | 1347 | WP_317052521.1 | PBSX family phage terminase large subunit | - |
| SGW11_RS04985 (SGW11_04985) | - | 1031809..1033143 (+) | 1335 | WP_244138848.1 | phage portal protein | - |
| SGW11_RS04990 (SGW11_04990) | - | 1033112..1034095 (+) | 984 | WP_317059637.1 | minor capsid protein | - |
| SGW11_RS04995 (SGW11_04995) | - | 1034198..1034914 (+) | 717 | WP_058121207.1 | DUF4355 domain-containing protein | - |
| SGW11_RS05000 (SGW11_05000) | - | 1034914..1035732 (+) | 819 | WP_317059638.1 | N4-gp56 family major capsid protein | - |
| SGW11_RS05005 (SGW11_05005) | - | 1035750..1036016 (+) | 267 | WP_128472106.1 | Ig-like domain-containing protein | - |
| SGW11_RS05010 (SGW11_05010) | - | 1036028..1036402 (+) | 375 | WP_317059639.1 | phage head-tail connector protein | - |
| SGW11_RS05015 (SGW11_05015) | - | 1036407..1036715 (+) | 309 | WP_317059640.1 | hypothetical protein | - |
| SGW11_RS05020 (SGW11_05020) | - | 1036708..1037049 (+) | 342 | WP_317059641.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SGW11_RS05025 (SGW11_05025) | - | 1037074..1037457 (+) | 384 | WP_195304627.1 | hypothetical protein | - |
| SGW11_RS05030 (SGW11_05030) | - | 1037469..1038125 (+) | 657 | WP_317059642.1 | phage major tail protein, TP901-1 family | - |
| SGW11_RS05035 (SGW11_05035) | - | 1038269..1038610 (+) | 342 | WP_317059782.1 | tail assembly chaperone | - |
| SGW11_RS05040 (SGW11_05040) | - | 1038757..1039035 (+) | 279 | WP_229038607.1 | hypothetical protein | - |
| SGW11_RS05045 (SGW11_05045) | - | 1039019..1042039 (+) | 3021 | WP_317059644.1 | phage tail tape measure protein | - |
| SGW11_RS05050 (SGW11_05050) | - | 1042039..1042803 (+) | 765 | WP_317059645.1 | phage tail protein | - |
| SGW11_RS05055 (SGW11_05055) | - | 1042803..1046342 (+) | 3540 | WP_317059646.1 | GDSL-type esterase/lipase family protein | - |
| SGW11_RS05060 (SGW11_05060) | - | 1046365..1046694 (+) | 330 | WP_317059647.1 | hypothetical protein | - |
| SGW11_RS05065 (SGW11_05065) | - | 1046694..1049507 (+) | 2814 | WP_317059648.1 | BppU family phage baseplate upper protein | - |
| SGW11_RS05070 (SGW11_05070) | - | 1049550..1050038 (+) | 489 | WP_317059649.1 | acyltransferase | - |
| SGW11_RS05075 (SGW11_05075) | - | 1050067..1050387 (+) | 321 | WP_128688434.1 | hypothetical protein | - |
| SGW11_RS05080 (SGW11_05080) | - | 1050387..1050632 (+) | 246 | WP_128688433.1 | phage holin | - |
| SGW11_RS05085 (SGW11_05085) | - | 1050616..1051737 (+) | 1122 | WP_317059650.1 | peptidoglycan recognition family protein | - |
| SGW11_RS05090 (SGW11_05090) | - | 1052638..1053984 (+) | 1347 | WP_317059651.1 | PTS sugar transporter subunit IIC | - |
| SGW11_RS05095 (SGW11_05095) | - | 1054007..1054891 (+) | 885 | WP_128211563.1 | ROK family protein | - |
| SGW11_RS05100 (SGW11_05100) | - | 1054884..1056251 (+) | 1368 | WP_317059652.1 | glycoside hydrolase family 1 protein | - |
| SGW11_RS05105 (SGW11_05105) | - | 1056244..1057215 (+) | 972 | WP_193223642.1 | alpha/beta hydrolase | - |
| SGW11_RS05110 (SGW11_05110) | - | 1057218..1058927 (+) | 1710 | WP_317059653.1 | DUF4091 domain-containing protein | - |
| SGW11_RS05115 (SGW11_05115) | - | 1058963..1059961 (+) | 999 | WP_193223644.1 | alpha/beta hydrolase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15748.52 Da Isoelectric Point: 7.9910
>NTDB_id=903246 SGW11_RS04905 WP_317059629.1 1022417..1022842(+) (ssb) [Pediococcus acidilactici strain IAF6519]
MINRTVLIGRLTRDVELRYTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTHKGSLVGIEGRIQTR
SYENQQGQRVYVTEIVADNFSLLDSKPKGNQQNNARQASTPGDLFANGGQSIDISDDQLPF
MINRTVLIGRLTRDVELRYTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTHKGSLVGIEGRIQTR
SYENQQGQRVYVTEIVADNFSLLDSKPKGNQQNNARQASTPGDLFANGGQSIDISDDQLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=903246 SGW11_RS04905 WP_317059629.1 1022417..1022842(+) (ssb) [Pediococcus acidilactici strain IAF6519]
ATGATTAATCGAACAGTACTAATAGGACGCCTAACTAGAGATGTTGAGCTTCGCTACACAGCTAAAGGAGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATCAACTGTGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCTAAGTATACACACAAGGGTTCGTTGGTAGGTATTGAAGGGCGGATTCAGACCCGT
TCATACGAAAACCAACAAGGGCAACGAGTATACGTTACCGAAATTGTGGCGGATAACTTCTCACTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCGGGAGATCTGTTCGCCAATGGTGGTCAATCAATCGACA
TTTCAGATGATCAGCTCCCCTTTTAG
ATGATTAATCGAACAGTACTAATAGGACGCCTAACTAGAGATGTTGAGCTTCGCTACACAGCTAAAGGAGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATCAACTGTGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCTAAGTATACACACAAGGGTTCGTTGGTAGGTATTGAAGGGCGGATTCAGACCCGT
TCATACGAAAACCAACAAGGGCAACGAGTATACGTTACCGAAATTGTGGCGGATAACTTCTCACTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCGGGAGATCTGTTCGCCAATGGTGGTCAATCAATCGACA
TTTCAGATGATCAGCTCCCCTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.824 |
100 |
0.709 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.645 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.185 |
76.596 |
0.461 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.662 |
100 |
0.44 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.845 |
100 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
37.589 |
100 |
0.376 |