Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | SGW15_RS02270 | Genome accession | NZ_CP138506 |
| Coordinates | 456771..457196 (+) | Length | 141 a.a. |
| NCBI ID | WP_317059629.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain IAF5919 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 446995..486091 | 456771..457196 | within | 0 |
Gene organization within MGE regions
Location: 446995..486091
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGW15_RS02195 (SGW15_02195) | - | 446995..447684 (-) | 690 | WP_008842223.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| SGW15_RS02200 (SGW15_02200) | - | 448080..449159 (-) | 1080 | WP_317059623.1 | tyrosine-type recombinase/integrase | - |
| SGW15_RS02205 (SGW15_02205) | - | 449297..450322 (-) | 1026 | WP_317059624.1 | Abi family protein | - |
| SGW15_RS02210 (SGW15_02210) | - | 450834..451031 (-) | 198 | WP_204201417.1 | hypothetical protein | - |
| SGW15_RS02215 (SGW15_02215) | - | 451182..452078 (-) | 897 | WP_317059625.1 | DUF5067 domain-containing protein | - |
| SGW15_RS02220 (SGW15_02220) | - | 452097..452657 (-) | 561 | WP_317059626.1 | hypothetical protein | - |
| SGW15_RS02225 (SGW15_02225) | - | 452682..453479 (-) | 798 | WP_323051940.1 | XRE family transcriptional regulator | - |
| SGW15_RS02230 (SGW15_02230) | - | 453736..453945 (+) | 210 | WP_065124225.1 | multiprotein-bridging factor 1 family protein | - |
| SGW15_RS02235 (SGW15_02235) | - | 453959..454693 (+) | 735 | Protein_414 | Rha family transcriptional regulator | - |
| SGW15_RS02240 (SGW15_02240) | - | 454762..454968 (+) | 207 | WP_070366337.1 | helix-turn-helix transcriptional regulator | - |
| SGW15_RS02245 (SGW15_02245) | - | 455065..455286 (+) | 222 | WP_193223205.1 | hypothetical protein | - |
| SGW15_RS02250 (SGW15_02250) | - | 455283..455564 (-) | 282 | WP_002830747.1 | hypothetical protein | - |
| SGW15_RS02255 (SGW15_02255) | - | 455712..455924 (+) | 213 | WP_317059628.1 | hypothetical protein | - |
| SGW15_RS02260 (SGW15_02260) | - | 455934..456569 (+) | 636 | WP_159206441.1 | ERF family protein | - |
| SGW15_RS02265 (SGW15_02265) | - | 456572..456778 (+) | 207 | WP_159206442.1 | hypothetical protein | - |
| SGW15_RS02270 (SGW15_02270) | ssb | 456771..457196 (+) | 426 | WP_317059629.1 | single-stranded DNA-binding protein | Machinery gene |
| SGW15_RS02275 (SGW15_02275) | - | 457208..457906 (+) | 699 | WP_317059630.1 | putative HNHc nuclease | - |
| SGW15_RS02280 (SGW15_02280) | - | 457887..458639 (+) | 753 | WP_058121223.1 | conserved phage C-terminal domain-containing protein | - |
| SGW15_RS02285 (SGW15_02285) | - | 458620..459435 (+) | 816 | WP_058121222.1 | ATP-binding protein | - |
| SGW15_RS02290 (SGW15_02290) | - | 459553..460185 (+) | 633 | WP_058121221.1 | hypothetical protein | - |
| SGW15_RS02295 (SGW15_02295) | - | 460166..460567 (+) | 402 | WP_204229941.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SGW15_RS02300 (SGW15_02300) | - | 460564..460713 (+) | 150 | WP_317059631.1 | hypothetical protein | - |
| SGW15_RS02305 (SGW15_02305) | - | 460700..461071 (+) | 372 | WP_317059632.1 | N-acetylmuramoyl-L-alanine amidase | - |
| SGW15_RS02310 (SGW15_02310) | - | 461240..461788 (+) | 549 | WP_317059633.1 | DUF1642 domain-containing protein | - |
| SGW15_RS02315 (SGW15_02315) | - | 461781..462089 (+) | 309 | WP_317059634.1 | hypothetical protein | - |
| SGW15_RS02320 (SGW15_02320) | - | 462089..462337 (+) | 249 | WP_317059635.1 | hypothetical protein | - |
| SGW15_RS02325 (SGW15_02325) | - | 462524..462712 (+) | 189 | WP_036672512.1 | hypothetical protein | - |
| SGW15_RS02330 (SGW15_02330) | - | 462913..463374 (+) | 462 | WP_002830416.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SGW15_RS02335 (SGW15_02335) | - | 463548..464180 (+) | 633 | WP_138492700.1 | hypothetical protein | - |
| SGW15_RS02340 (SGW15_02340) | - | 464251..464742 (+) | 492 | WP_317059636.1 | terminase small subunit | - |
| SGW15_RS02345 (SGW15_02345) | - | 464735..466081 (+) | 1347 | WP_317052521.1 | PBSX family phage terminase large subunit | - |
| SGW15_RS02350 (SGW15_02350) | - | 466163..467497 (+) | 1335 | WP_244138848.1 | phage portal protein | - |
| SGW15_RS02355 (SGW15_02355) | - | 467466..468449 (+) | 984 | WP_317059637.1 | minor capsid protein | - |
| SGW15_RS02360 (SGW15_02360) | - | 468552..469268 (+) | 717 | WP_058121207.1 | DUF4355 domain-containing protein | - |
| SGW15_RS02365 (SGW15_02365) | - | 469268..470086 (+) | 819 | WP_317059638.1 | N4-gp56 family major capsid protein | - |
| SGW15_RS02370 (SGW15_02370) | - | 470104..470370 (+) | 267 | WP_128472106.1 | Ig-like domain-containing protein | - |
| SGW15_RS02375 (SGW15_02375) | - | 470382..470756 (+) | 375 | WP_317059639.1 | phage head-tail connector protein | - |
| SGW15_RS02380 (SGW15_02380) | - | 470761..471069 (+) | 309 | WP_317059640.1 | hypothetical protein | - |
| SGW15_RS02385 (SGW15_02385) | - | 471062..471403 (+) | 342 | WP_317059641.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SGW15_RS02390 (SGW15_02390) | - | 471428..471811 (+) | 384 | WP_195304627.1 | hypothetical protein | - |
| SGW15_RS02395 (SGW15_02395) | - | 471823..472479 (+) | 657 | WP_317059642.1 | phage major tail protein, TP901-1 family | - |
| SGW15_RS02400 (SGW15_02400) | - | 472623..472964 (+) | 342 | WP_317059782.1 | tail assembly chaperone | - |
| SGW15_RS02405 (SGW15_02405) | - | 473111..473389 (+) | 279 | WP_229038607.1 | hypothetical protein | - |
| SGW15_RS02410 (SGW15_02410) | - | 473373..476393 (+) | 3021 | WP_317059644.1 | phage tail tape measure protein | - |
| SGW15_RS02415 (SGW15_02415) | - | 476393..477157 (+) | 765 | WP_317059645.1 | phage tail protein | - |
| SGW15_RS02420 (SGW15_02420) | - | 477157..480696 (+) | 3540 | WP_317059646.1 | GDSL-type esterase/lipase family protein | - |
| SGW15_RS02425 (SGW15_02425) | - | 480719..481048 (+) | 330 | WP_317059647.1 | hypothetical protein | - |
| SGW15_RS02430 (SGW15_02430) | - | 481048..483861 (+) | 2814 | WP_317059648.1 | BppU family phage baseplate upper protein | - |
| SGW15_RS02435 (SGW15_02435) | - | 483904..484392 (+) | 489 | WP_317059649.1 | acyltransferase | - |
| SGW15_RS02440 (SGW15_02440) | - | 484421..484741 (+) | 321 | WP_128688434.1 | hypothetical protein | - |
| SGW15_RS02445 (SGW15_02445) | - | 484741..484986 (+) | 246 | WP_128688433.1 | phage holin | - |
| SGW15_RS02450 (SGW15_02450) | - | 484970..486091 (+) | 1122 | WP_317059650.1 | peptidoglycan recognition family protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15748.52 Da Isoelectric Point: 7.9910
>NTDB_id=903218 SGW15_RS02270 WP_317059629.1 456771..457196(+) (ssb) [Pediococcus acidilactici strain IAF5919]
MINRTVLIGRLTRDVELRYTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTHKGSLVGIEGRIQTR
SYENQQGQRVYVTEIVADNFSLLDSKPKGNQQNNARQASTPGDLFANGGQSIDISDDQLPF
MINRTVLIGRLTRDVELRYTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTHKGSLVGIEGRIQTR
SYENQQGQRVYVTEIVADNFSLLDSKPKGNQQNNARQASTPGDLFANGGQSIDISDDQLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=903218 SGW15_RS02270 WP_317059629.1 456771..457196(+) (ssb) [Pediococcus acidilactici strain IAF5919]
ATGATTAATCGAACAGTACTAATAGGACGCCTAACTAGAGATGTTGAGCTTCGCTACACAGCTAAAGGAGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATCAACTGTGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCTAAGTATACACACAAGGGTTCGTTGGTAGGTATTGAAGGGCGGATTCAGACCCGT
TCATACGAAAACCAACAAGGGCAACGAGTATACGTTACCGAAATTGTGGCGGATAACTTCTCACTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCGGGAGATCTGTTCGCCAATGGTGGTCAATCAATCGACA
TTTCAGATGATCAGCTCCCCTTTTAG
ATGATTAATCGAACAGTACTAATAGGACGCCTAACTAGAGATGTTGAGCTTCGCTACACAGCTAAAGGAGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATCAACTGTGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCTAAGTATACACACAAGGGTTCGTTGGTAGGTATTGAAGGGCGGATTCAGACCCGT
TCATACGAAAACCAACAAGGGCAACGAGTATACGTTACCGAAATTGTGGCGGATAACTTCTCACTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAATGCACGGCAAGCATCAACGCCGGGAGATCTGTTCGCCAATGGTGGTCAATCAATCGACA
TTTCAGATGATCAGCTCCCCTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.824 |
100 |
0.709 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.645 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.185 |
76.596 |
0.461 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.662 |
100 |
0.44 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.845 |
100 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
37.589 |
100 |
0.376 |