Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | SGW13_RS01385 | Genome accession | NZ_CP138502 |
| Coordinates | 268530..268955 (+) | Length | 141 a.a. |
| NCBI ID | WP_138492714.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain AF2019 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 261022..303166 | 268530..268955 | within | 0 |
Gene organization within MGE regions
Location: 261022..303166
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGW13_RS01320 (SGW13_01320) | - | 261022..262086 (-) | 1065 | WP_323052267.1 | site-specific integrase | - |
| SGW13_RS01325 (SGW13_01325) | - | 262219..263346 (-) | 1128 | WP_323052268.1 | hypothetical protein | - |
| SGW13_RS01330 (SGW13_01330) | - | 263403..264029 (-) | 627 | WP_323052269.1 | LexA family protein | - |
| SGW13_RS01335 (SGW13_01335) | - | 264295..264519 (+) | 225 | WP_323052270.1 | hypothetical protein | - |
| SGW13_RS01340 (SGW13_01340) | - | 264619..264825 (+) | 207 | WP_323052271.1 | hypothetical protein | - |
| SGW13_RS01345 (SGW13_01345) | - | 264815..265123 (-) | 309 | WP_058120778.1 | hypothetical protein | - |
| SGW13_RS01350 (SGW13_01350) | - | 265291..265620 (-) | 330 | WP_323052272.1 | hypothetical protein | - |
| SGW13_RS01355 (SGW13_01355) | - | 265679..266425 (+) | 747 | WP_323052273.1 | Rha family transcriptional regulator | - |
| SGW13_RS01360 (SGW13_01360) | - | 266470..266676 (+) | 207 | WP_323052274.1 | hypothetical protein | - |
| SGW13_RS01365 (SGW13_01365) | - | 266773..266994 (+) | 222 | WP_323052275.1 | hypothetical protein | - |
| SGW13_RS01370 (SGW13_01370) | - | 267154..267612 (+) | 459 | WP_235015673.1 | chromosome segregation protein SMC | - |
| SGW13_RS01375 (SGW13_01375) | - | 267613..268338 (+) | 726 | WP_138492715.1 | ERF family protein | - |
| SGW13_RS01380 (SGW13_01380) | - | 268331..268537 (+) | 207 | WP_024863113.1 | hypothetical protein | - |
| SGW13_RS01385 (SGW13_01385) | ssb | 268530..268955 (+) | 426 | WP_138492714.1 | single-stranded DNA-binding protein | Machinery gene |
| SGW13_RS01390 (SGW13_01390) | - | 268966..269649 (+) | 684 | WP_323052276.1 | putative HNHc nuclease | - |
| SGW13_RS01395 (SGW13_01395) | - | 269633..269863 (+) | 231 | WP_128211864.1 | hypothetical protein | - |
| SGW13_RS01400 (SGW13_01400) | - | 269901..270623 (+) | 723 | WP_323052277.1 | hypothetical protein | - |
| SGW13_RS01405 (SGW13_01405) | - | 270604..271419 (+) | 816 | WP_323052278.1 | ATP-binding protein | - |
| SGW13_RS01410 (SGW13_01410) | - | 271537..272169 (+) | 633 | WP_323052054.1 | RNA polymerase subunit sigma-70 | - |
| SGW13_RS01415 (SGW13_01415) | - | 272188..272352 (+) | 165 | WP_323052053.1 | hypothetical protein | - |
| SGW13_RS01420 (SGW13_01420) | - | 272324..272695 (+) | 372 | WP_323052052.1 | N-acetylmuramoyl-L-alanine amidase | - |
| SGW13_RS01425 (SGW13_01425) | - | 272864..273412 (+) | 549 | WP_323052051.1 | DUF1642 domain-containing protein | - |
| SGW13_RS01430 (SGW13_01430) | - | 273405..273716 (+) | 312 | WP_323052050.1 | hypothetical protein | - |
| SGW13_RS01435 (SGW13_01435) | - | 273713..273907 (+) | 195 | WP_323052049.1 | hypothetical protein | - |
| SGW13_RS01440 (SGW13_01440) | - | 273912..274232 (+) | 321 | WP_138492705.1 | hypothetical protein | - |
| SGW13_RS01445 (SGW13_01445) | - | 274246..274530 (+) | 285 | WP_323052048.1 | hypothetical protein | - |
| SGW13_RS01450 (SGW13_01450) | - | 274530..274790 (+) | 261 | WP_323052047.1 | hypothetical protein | - |
| SGW13_RS01455 (SGW13_01455) | - | 274791..275078 (+) | 288 | WP_323052046.1 | hypothetical protein | - |
| SGW13_RS01460 (SGW13_01460) | - | 275081..275281 (+) | 201 | WP_323052045.1 | hypothetical protein | - |
| SGW13_RS01465 (SGW13_01465) | - | 275278..275442 (+) | 165 | WP_176582130.1 | hypothetical protein | - |
| SGW13_RS01470 (SGW13_01470) | - | 275581..276024 (+) | 444 | WP_323052279.1 | hypothetical protein | - |
| SGW13_RS01475 (SGW13_01475) | - | 276441..276899 (+) | 459 | WP_323052280.1 | HNH endonuclease signature motif containing protein | - |
| SGW13_RS01480 (SGW13_01480) | - | 276896..277198 (+) | 303 | WP_323052281.1 | hypothetical protein | - |
| SGW13_RS01485 (SGW13_01485) | - | 277191..277505 (+) | 315 | WP_323052282.1 | hypothetical protein | - |
| SGW13_RS01490 (SGW13_01490) | - | 277641..278105 (+) | 465 | WP_160216136.1 | phage terminase small subunit P27 family | - |
| SGW13_RS01495 (SGW13_01495) | - | 278105..279979 (+) | 1875 | WP_323052283.1 | terminase TerL endonuclease subunit | - |
| SGW13_RS01500 (SGW13_01500) | - | 280176..281291 (+) | 1116 | WP_323052284.1 | phage portal protein | - |
| SGW13_RS01505 (SGW13_01505) | - | 281275..281865 (+) | 591 | WP_323052285.1 | HK97 family phage prohead protease | - |
| SGW13_RS01510 (SGW13_01510) | - | 281866..283218 (+) | 1353 | WP_323052286.1 | phage major capsid protein | - |
| SGW13_RS01515 (SGW13_01515) | - | 283271..283594 (+) | 324 | WP_323052287.1 | head-tail connector protein | - |
| SGW13_RS01520 (SGW13_01520) | - | 283575..283919 (+) | 345 | WP_160185833.1 | phage head closure protein | - |
| SGW13_RS01525 (SGW13_01525) | - | 283912..284334 (+) | 423 | WP_323052288.1 | HK97 gp10 family phage protein | - |
| SGW13_RS01530 (SGW13_01530) | - | 284337..284723 (+) | 387 | WP_323052289.1 | DUF806 family protein | - |
| SGW13_RS01535 (SGW13_01535) | - | 284723..285328 (+) | 606 | WP_323052290.1 | phage tail protein | - |
| SGW13_RS01540 (SGW13_01540) | - | 285464..285877 (+) | 414 | WP_193223631.1 | phage tail tube assembly chaperone | - |
| SGW13_RS01545 (SGW13_01545) | - | 286086..291005 (+) | 4920 | WP_323052291.1 | tape measure protein | - |
| SGW13_RS01550 (SGW13_01550) | - | 291021..291854 (+) | 834 | WP_323052292.1 | phage tail domain-containing protein | - |
| SGW13_RS01555 (SGW13_01555) | - | 291784..293007 (+) | 1224 | WP_323052293.1 | phage tail protein | - |
| SGW13_RS01560 (SGW13_01560) | - | 292997..293320 (+) | 324 | WP_323052294.1 | hypothetical protein | - |
| SGW13_RS01565 (SGW13_01565) | - | 293310..293597 (+) | 288 | WP_323052295.1 | hypothetical protein | - |
| SGW13_RS01570 (SGW13_01570) | - | 293597..295438 (+) | 1842 | WP_323052296.1 | phage baseplate upper protein | - |
| SGW13_RS01575 (SGW13_01575) | - | 295453..296190 (+) | 738 | WP_323052297.1 | hypothetical protein | - |
| SGW13_RS01580 (SGW13_01580) | - | 296190..296525 (+) | 336 | WP_323052298.1 | DUF2977 domain-containing protein | - |
| SGW13_RS01585 (SGW13_01585) | - | 296528..296686 (+) | 159 | WP_323052299.1 | XkdX family protein | - |
| SGW13_RS01590 (SGW13_01590) | - | 296729..297019 (+) | 291 | WP_248616918.1 | hypothetical protein | - |
| SGW13_RS01595 (SGW13_01595) | - | 297019..297273 (+) | 255 | WP_323052300.1 | phage holin | - |
| SGW13_RS01600 (SGW13_01600) | - | 297257..298585 (+) | 1329 | WP_323052301.1 | GH25 family lysozyme | - |
| SGW13_RS01605 (SGW13_01605) | - | 300400..301047 (-) | 648 | WP_323052302.1 | type II CAAX endopeptidase family protein | - |
| SGW13_RS01610 (SGW13_01610) | groES | 301237..301521 (+) | 285 | WP_002829962.1 | co-chaperone GroES | - |
| SGW13_RS01615 (SGW13_01615) | groL | 301544..303166 (+) | 1623 | WP_323052303.1 | chaperonin GroEL | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15658.39 Da Isoelectric Point: 7.9972
>NTDB_id=903193 SGW13_RS01385 WP_138492714.1 268530..268955(+) (ssb) [Pediococcus acidilactici strain AF2019]
MINRTVLIGRLTKDVELRHTTKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIDGRIQTR
SYENQQGQRVYVTEIVAENFSLLDSKPKGNQQNNARQSTTPGDPFANGGQSIDIGDDSLPF
MINRTVLIGRLTKDVELRHTTKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIDGRIQTR
SYENQQGQRVYVTEIVAENFSLLDSKPKGNQQNNARQSTTPGDPFANGGQSIDIGDDSLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=903193 SGW13_RS01385 WP_138492714.1 268530..268955(+) (ssb) [Pediococcus acidilactici strain AF2019]
ATGATTAATCGAACAGTACTAATAGGACGCCTAACTAAAGATGTTGAACTTCGCCACACGACTAAAGGCGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAAGCGGCGGAAAACTTTGCTAAGTATACACAAAAAGGTTCGTTGGTAGGCATTGACGGTCGGATTCAGACCCGT
TCGTATGAGAATCAACAAGGGCAACGAGTTTATGTTACCGAAATTGTGGCGGAGAACTTCTCACTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAACGCACGGCAATCTACAACGCCAGGAGATCCGTTCGCTAATGGCGGACAGTCAATTGATA
TTGGTGACGATAGTTTGCCTTTCTAA
ATGATTAATCGAACAGTACTAATAGGACGCCTAACTAAAGATGTTGAACTTCGCCACACGACTAAAGGCGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATCAACTGTGTAATGT
GGCGTAAAGCGGCGGAAAACTTTGCTAAGTATACACAAAAAGGTTCGTTGGTAGGCATTGACGGTCGGATTCAGACCCGT
TCGTATGAGAATCAACAAGGGCAACGAGTTTATGTTACCGAAATTGTGGCGGAGAACTTCTCACTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAACGCACGGCAATCTACAACGCCAGGAGATCCGTTCGCTAATGGCGGACAGTCAATTGATA
TTGGTGACGATAGTTTGCCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.824 |
100 |
0.709 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.488 |
100 |
0.652 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.185 |
76.596 |
0.461 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.845 |
100 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
37.324 |
100 |
0.376 |