Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SE858_RS05260 | Genome accession | NZ_CP138368 |
| Coordinates | 1040606..1041001 (+) | Length | 131 a.a. |
| NCBI ID | WP_000282447.1 | Uniprot ID | A0AAV3JLT6 |
| Organism | Streptococcus agalactiae strain SagR92 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1034347..1073515 | 1040606..1041001 | within | 0 |
Gene organization within MGE regions
Location: 1034347..1073515
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SE858_RS05205 (SE858_05205) | - | 1034347..1034553 (+) | 207 | WP_000798241.1 | helix-turn-helix transcriptional regulator | - |
| SE858_RS05210 (SE858_05210) | - | 1034612..1034749 (+) | 138 | WP_001865900.1 | hypothetical protein | - |
| SE858_RS05215 (SE858_05215) | - | 1034790..1035245 (+) | 456 | WP_319163475.1 | hypothetical protein | - |
| SE858_RS05220 (SE858_05220) | - | 1035314..1035979 (+) | 666 | WP_000008113.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SE858_RS05225 (SE858_05225) | proC | 1036000..1036770 (-) | 771 | WP_001865901.1 | pyrroline-5-carboxylate reductase | - |
| SE858_RS05230 (SE858_05230) | pepA | 1036840..1037907 (-) | 1068 | WP_001281323.1 | glutamyl aminopeptidase | - |
| SE858_RS05235 (SE858_05235) | - | 1038092..1038331 (-) | 240 | WP_000660180.1 | hypothetical protein | - |
| SE858_RS05240 (SE858_05240) | - | 1038492..1038776 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| SE858_RS05245 (SE858_05245) | - | 1038773..1039096 (+) | 324 | WP_000602781.1 | thioredoxin family protein | - |
| SE858_RS05250 (SE858_05250) | ytpR | 1039129..1039755 (+) | 627 | WP_000578327.1 | YtpR family tRNA-binding protein | - |
| SE858_RS05255 (SE858_05255) | - | 1039809..1040525 (-) | 717 | WP_000186185.1 | class I SAM-dependent methyltransferase | - |
| SE858_RS05260 (SE858_05260) | ssbA | 1040606..1041001 (+) | 396 | WP_000282447.1 | single-stranded DNA-binding protein | Machinery gene |
| SE858_RS05265 (SE858_05265) | - | 1041125..1041769 (+) | 645 | WP_000416612.1 | HAD family phosphatase | - |
| SE858_RS05270 (SE858_05270) | - | 1041796..1043541 (+) | 1746 | WP_000930334.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| SE858_RS05275 (SE858_05275) | - | 1043522..1044262 (+) | 741 | WP_000697630.1 | LytTR family DNA-binding domain-containing protein | - |
| SE858_RS05280 (SE858_05280) | - | 1044432..1044887 (+) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| SE858_RS05285 (SE858_05285) | lrgB | 1044889..1045617 (+) | 729 | WP_000421724.1 | antiholin-like protein LrgB | - |
| SE858_RS05290 (SE858_05290) | - | 1045860..1047488 (+) | 1629 | WP_000170507.1 | ABC transporter substrate-binding protein | - |
| SE858_RS05295 (SE858_05295) | - | 1047601..1048578 (+) | 978 | WP_000680645.1 | ABC transporter permease | - |
| SE858_RS05300 (SE858_05300) | - | 1048575..1049396 (+) | 822 | WP_000603397.1 | ABC transporter permease | - |
| SE858_RS05305 (SE858_05305) | - | 1049408..1050211 (+) | 804 | WP_000140984.1 | ABC transporter ATP-binding protein | - |
| SE858_RS05310 (SE858_05310) | - | 1050195..1050821 (+) | 627 | WP_000171309.1 | ABC transporter ATP-binding protein | - |
| SE858_RS05315 (SE858_05315) | treP | 1051104..1053134 (+) | 2031 | WP_000434616.1 | PTS system trehalose-specific EIIBC component | - |
| SE858_RS05320 (SE858_05320) | treC | 1053356..1054981 (+) | 1626 | WP_000151017.1 | alpha,alpha-phosphotrehalase | - |
| SE858_RS05325 (SE858_05325) | - | 1055197..1057233 (+) | 2037 | WP_000228183.1 | BglG family transcription antiterminator | - |
| SE858_RS05330 (SE858_05330) | - | 1057236..1057520 (+) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| SE858_RS05335 (SE858_05335) | - | 1057533..1058888 (+) | 1356 | WP_000677360.1 | PTS ascorbate transporter subunit IIC | - |
| SE858_RS05340 (SE858_05340) | - | 1058891..1059748 (+) | 858 | WP_000203489.1 | transketolase | - |
| SE858_RS05345 (SE858_05345) | - | 1059745..1060674 (+) | 930 | WP_001203821.1 | transketolase family protein | - |
| SE858_RS05350 (SE858_05350) | - | 1060783..1062042 (+) | 1260 | WP_001203068.1 | ferric reductase-like transmembrane domain-containing protein | - |
| SE858_RS05355 (SE858_05355) | rpsO | 1062130..1062399 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| SE858_RS05360 (SE858_05360) | pnp | 1062780..1064909 (+) | 2130 | WP_000043850.1 | polyribonucleotide nucleotidyltransferase | - |
| SE858_RS05365 (SE858_05365) | - | 1064911..1065663 (+) | 753 | WP_000204782.1 | SseB family protein | - |
| SE858_RS05370 (SE858_05370) | cysE | 1065672..1066256 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| SE858_RS05375 (SE858_05375) | - | 1066266..1066448 (+) | 183 | WP_000656476.1 | lipoprotein | - |
| SE858_RS05380 (SE858_05380) | cysS | 1066445..1067788 (+) | 1344 | WP_000591131.1 | cysteine--tRNA ligase | - |
| SE858_RS05385 (SE858_05385) | - | 1067781..1068167 (+) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| SE858_RS05390 (SE858_05390) | rlmB | 1068270..1069025 (+) | 756 | WP_000178026.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| SE858_RS05395 (SE858_05395) | - | 1069022..1069540 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| SE858_RS05400 (SE858_05400) | - | 1069633..1070493 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| SE858_RS05405 (SE858_05405) | - | 1071030..1071149 (+) | 120 | Protein_1016 | helix-turn-helix transcriptional regulator | - |
| SE858_RS05410 (SE858_05410) | rplM | 1071374..1071820 (+) | 447 | WP_001865567.1 | 50S ribosomal protein L13 | - |
| SE858_RS05415 (SE858_05415) | rpsI | 1071841..1072233 (+) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
| SE858_RS05420 (SE858_05420) | - | 1072361..1073515 (-) | 1155 | WP_000022165.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14774.80 Da Isoelectric Point: 7.0189
>NTDB_id=902300 SE858_RS05260 WP_000282447.1 1040606..1041001(+) (ssbA) [Streptococcus agalactiae strain SagR92]
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=902300 SE858_RS05260 WP_000282447.1 1040606..1041001(+) (ssbA) [Streptococcus agalactiae strain SagR92]
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA
ACGTGCTATGCGTGAAAATAACGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA
ACGTGCTATGCGTGAAAATAACGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
80.916 |
100 |
0.809 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
77.099 |
100 |
0.771 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
77.099 |
100 |
0.771 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus mitis SK321 |
76.336 |
100 |
0.763 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
60.526 |
87.023 |
0.527 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.018 |
86.26 |
0.397 |