Detailed information NTG0902121

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: SE087_RS07800
• Genome accession: NZ_CP138360
• Coordinates: 1615305..1615616 (-)
• Length: 103 a.a.
• NCBI ID: WP_217175768.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain 17CS1042
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1610305..1620616

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SE087_RS07765 (SE087_07765)	gcvPA	1610807..1612153 (-)	1347	WP_217175765.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
SE087_RS07770 (SE087_07770)	gcvT	1612173..1613264 (-)	1092	WP_000093354.1	glycine cleavage system aminomethyltransferase GcvT	-
SE087_RS07775 (SE087_07775)	-	1613423..1613947 (-)	525	WP_217175766.1	shikimate kinase	-
SE087_RS07780 (SE087_07780)	-	1613937..1614083 (-)	147	WP_001789879.1	hypothetical protein	-
SE087_RS07785 (SE087_07785)	comGF	1614180..1614677 (-)	498	WP_319078544.1	competence type IV pilus minor pilin ComGF	Machinery gene
SE087_RS07790 (SE087_07790)	comGE	1614595..1614894 (-)	300	WP_217175767.1	competence protein ComGE	Machinery gene
SE087_RS07795 (SE087_07795)	comGD	1614881..1615327 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
SE087_RS07800 (SE087_07800)	comGC	1615305..1615616 (-)	312	WP_217175768.1	competence type IV pilus major pilin ComGC	Machinery gene
SE087_RS07805 (SE087_07805)	comGB	1615630..1616700 (-)	1071	WP_197840165.1	competence type IV pilus assembly protein ComGB	Machinery gene
SE087_RS07810 (SE087_07810)	comGA	1616672..1617646 (-)	975	Protein_1535	competence type IV pilus ATPase ComGA	-
SE087_RS07815 (SE087_07815)	-	1617698..1618321 (-)	624	WP_179321523.1	MBL fold metallo-hydrolase	-
SE087_RS07820 (SE087_07820)	-	1618303..1618647 (-)	345	WP_217175769.1	MTH1187 family thiamine-binding protein	-
SE087_RS07825 (SE087_07825)	-	1618647..1619633 (-)	987	WP_000161315.1	ROK family glucokinase	-
SE087_RS07830 (SE087_07830)	-	1619630..1619833 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11345.38 Da
• Isoelectric Point: 8.5268

>NTDB_id=902121 SE087_RS07800 WP_217175768.1 1615305..1615616(-) (comGC) [Staphylococcus aureus strain 17CS1042]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNTQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=902121 SE087_RS07800 WP_217175768.1 1615305..1615616(-) (comGC) [Staphylococcus aureus strain 17CS1042]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATACACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae R6	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae TIGR4	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae Rx1	45.098	99.029	0.447
comGC/cglC	Streptococcus mitis NCTC 12261	50	83.495	0.417
comYC	Streptococcus gordonii str. Challis substr. CH1	41.837	95.146	0.398
comYC	Streptococcus suis isolate S10	48.718	75.728	0.369
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369