Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SE087_RS05470 | Genome accession | NZ_CP138360 |
| Coordinates | 1112656..1113081 (+) | Length | 141 a.a. |
| NCBI ID | WP_319096127.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 17CS1042 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1103911..1147470 | 1112656..1113081 | within | 0 |
Gene organization within MGE regions
Location: 1103911..1147470
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SE087_RS05375 (SE087_05375) | - | 1103911..1105296 (-) | 1386 | WP_135830970.1 | recombinase family protein | - |
| SE087_RS05380 (SE087_05380) | - | 1105506..1106186 (-) | 681 | WP_224061793.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| SE087_RS05385 (SE087_05385) | - | 1106218..1106682 (-) | 465 | WP_000525003.1 | hypothetical protein | - |
| SE087_RS05390 (SE087_05390) | - | 1106695..1107018 (-) | 324 | WP_001260487.1 | helix-turn-helix domain-containing protein | - |
| SE087_RS05395 (SE087_05395) | - | 1107182..1107430 (+) | 249 | WP_000272858.1 | helix-turn-helix domain-containing protein | - |
| SE087_RS05400 (SE087_05400) | - | 1107446..1107589 (+) | 144 | WP_002478861.1 | hypothetical protein | - |
| SE087_RS05405 (SE087_05405) | - | 1107599..1108201 (-) | 603 | WP_224061794.1 | hypothetical protein | - |
| SE087_RS05410 (SE087_05410) | - | 1108645..1108830 (+) | 186 | WP_000933365.1 | helix-turn-helix domain-containing protein | - |
| SE087_RS05415 (SE087_05415) | - | 1108832..1109623 (+) | 792 | WP_001148575.1 | phage antirepressor | - |
| SE087_RS05420 (SE087_05420) | tscA | 1109624..1109848 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| SE087_RS05425 (SE087_05425) | - | 1109888..1110091 (+) | 204 | Protein_1058 | hypothetical protein | - |
| SE087_RS05430 (SE087_05430) | - | 1110059..1110304 (-) | 246 | WP_000122243.1 | hypothetical protein | - |
| SE087_RS05435 (SE087_05435) | - | 1110359..1110649 (+) | 291 | WP_069989853.1 | hypothetical protein | - |
| SE087_RS05440 (SE087_05440) | - | 1110661..1110831 (-) | 171 | WP_165602188.1 | hypothetical protein | - |
| SE087_RS05445 (SE087_05445) | - | 1110881..1111027 (+) | 147 | WP_159427156.1 | hypothetical protein | - |
| SE087_RS05450 (SE087_05450) | - | 1111011..1111172 (+) | 162 | WP_224061795.1 | DUF1270 family protein | - |
| SE087_RS05455 (SE087_05455) | - | 1111264..1111524 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| SE087_RS05460 (SE087_05460) | - | 1111539..1112018 (+) | 480 | WP_000002517.1 | siphovirus Gp157 family protein | - |
| SE087_RS05465 (SE087_05465) | - | 1112018..1112656 (+) | 639 | WP_001043063.1 | ERF family protein | - |
| SE087_RS05470 (SE087_05470) | ssbA | 1112656..1113081 (+) | 426 | WP_319096127.1 | single-stranded DNA-binding protein | Machinery gene |
| SE087_RS05475 (SE087_05475) | - | 1113095..1113769 (+) | 675 | WP_319096129.1 | putative HNHc nuclease | - |
| SE087_RS05480 (SE087_05480) | - | 1113875..1114732 (-) | 858 | WP_319096130.1 | DUF4393 domain-containing protein | - |
| SE087_RS05485 (SE087_05485) | - | 1114796..1115536 (+) | 741 | WP_319096132.1 | DnaD domain protein | - |
| SE087_RS05490 (SE087_05490) | - | 1115546..1116319 (+) | 774 | WP_000803049.1 | ATP-binding protein | - |
| SE087_RS05495 (SE087_05495) | - | 1116313..1116471 (+) | 159 | WP_274409778.1 | hypothetical protein | - |
| SE087_RS05500 (SE087_05500) | - | 1116484..1116705 (+) | 222 | WP_319096136.1 | DUF3269 family protein | - |
| SE087_RS05505 (SE087_05505) | - | 1116716..1117120 (+) | 405 | WP_015973976.1 | DUF1064 domain-containing protein | - |
| SE087_RS05510 (SE087_05510) | - | 1117125..1117310 (+) | 186 | WP_015980407.1 | DUF3113 family protein | - |
| SE087_RS05515 (SE087_05515) | - | 1117311..1117579 (+) | 269 | Protein_1076 | helix-turn-helix domain-containing protein | - |
| SE087_RS05520 (SE087_05520) | - | 1117580..1117951 (+) | 372 | WP_015980408.1 | SA1788 family PVL leukocidin-associated protein | - |
| SE087_RS05525 (SE087_05525) | - | 1117952..1118200 (+) | 249 | WP_015980409.1 | phi PVL orf 51-like protein | - |
| SE087_RS05530 (SE087_05530) | - | 1118272..1118499 (+) | 228 | Protein_1079 | hypothetical protein | - |
| SE087_RS05535 (SE087_05535) | - | 1118492..1118740 (+) | 249 | WP_065317236.1 | DUF1024 family protein | - |
| SE087_RS05540 (SE087_05540) | - | 1118733..1119245 (+) | 513 | WP_000181820.1 | dUTP diphosphatase | - |
| SE087_RS05545 (SE087_05545) | - | 1119282..1119488 (+) | 207 | WP_319096138.1 | DUF1381 domain-containing protein | - |
| SE087_RS05550 (SE087_05550) | rinB | 1119485..1119658 (+) | 174 | WP_319096140.1 | transcriptional activator RinB | - |
| SE087_RS05555 (SE087_05555) | - | 1119659..1119805 (+) | 147 | WP_250164437.1 | hypothetical protein | - |
| SE087_RS05560 (SE087_05560) | - | 1119822..1120223 (+) | 402 | WP_043044220.1 | hypothetical protein | - |
| SE087_RS05565 (SE087_05565) | - | 1120578..1121072 (+) | 495 | WP_000594079.1 | terminase small subunit | - |
| SE087_RS05570 (SE087_05570) | - | 1121065..1121433 (+) | 369 | Protein_1087 | PBSX family phage terminase large subunit | - |
| SE087_RS05575 (SE087_05575) | - | 1121553..1122392 (+) | 840 | WP_319096145.1 | NUMOD3 domain-containing DNA-binding protein | - |
| SE087_RS05580 (SE087_05580) | - | 1122588..1123442 (+) | 855 | Protein_1089 | PBSX family phage terminase large subunit | - |
| SE087_RS05585 (SE087_05585) | - | 1123439..1124863 (+) | 1425 | WP_319096147.1 | phage portal protein | - |
| SE087_RS05590 (SE087_05590) | - | 1124832..1125782 (+) | 951 | WP_065316473.1 | phage head morphogenesis protein | - |
| SE087_RS05595 (SE087_05595) | - | 1125786..1126019 (+) | 234 | WP_065316474.1 | hypothetical protein | - |
| SE087_RS05600 (SE087_05600) | - | 1126123..1126707 (+) | 585 | WP_065317044.1 | DUF4355 domain-containing protein | - |
| SE087_RS05605 (SE087_05605) | - | 1126724..1127638 (+) | 915 | WP_000235170.1 | phage major capsid protein | - |
| SE087_RS05610 (SE087_05610) | - | 1127650..1127793 (+) | 144 | WP_000002930.1 | hypothetical protein | - |
| SE087_RS05615 (SE087_05615) | - | 1127799..1128149 (+) | 351 | WP_000177353.1 | phage head-tail adapter protein | - |
| SE087_RS05620 (SE087_05620) | - | 1128161..1128496 (+) | 336 | WP_046597548.1 | phage head closure protein | - |
| SE087_RS05625 (SE087_05625) | - | 1128483..1128890 (+) | 408 | WP_319096152.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SE087_RS05630 (SE087_05630) | - | 1128903..1129328 (+) | 426 | WP_000270192.1 | DUF3168 domain-containing protein | - |
| SE087_RS05635 (SE087_05635) | - | 1129329..1129886 (+) | 558 | WP_000057585.1 | hypothetical protein | - |
| SE087_RS05640 (SE087_05640) | - | 1129953..1130465 (+) | 513 | WP_000134336.1 | tail assembly chaperone | - |
| SE087_RS05645 (SE087_05645) | - | 1130645..1130794 (+) | 150 | WP_000090259.1 | hypothetical protein | - |
| SE087_RS05650 (SE087_05650) | - | 1130798..1133683 (+) | 2886 | WP_319096160.1 | terminase | - |
| SE087_RS05655 (SE087_05655) | - | 1133698..1134639 (+) | 942 | WP_319096162.1 | phage tail domain-containing protein | - |
| SE087_RS05660 (SE087_05660) | - | 1134650..1136536 (+) | 1887 | WP_319096164.1 | SGNH/GDSL hydrolase family protein | - |
| SE087_RS05665 (SE087_05665) | - | 1136549..1138447 (+) | 1899 | WP_319096166.1 | hypothetical protein | - |
| SE087_RS05670 (SE087_05670) | - | 1138447..1140270 (+) | 1824 | WP_249525599.1 | phage baseplate upper protein | - |
| SE087_RS05675 (SE087_05675) | - | 1140270..1140647 (+) | 378 | WP_319096171.1 | DUF2977 domain-containing protein | - |
| SE087_RS05680 (SE087_05680) | - | 1140657..1140830 (+) | 174 | WP_001800921.1 | XkdX family protein | - |
| SE087_RS05685 (SE087_05685) | - | 1140871..1141170 (+) | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
| SE087_RS05690 (SE087_05690) | - | 1141762..1143531 (+) | 1770 | Protein_1111 | glucosaminidase domain-containing protein | - |
| SE087_RS05695 (SE087_05695) | - | 1143544..1144140 (+) | 597 | Protein_1112 | BppU family phage baseplate upper protein | - |
| SE087_RS05700 (SE087_05700) | - | 1145607..1146044 (+) | 438 | WP_015977660.1 | phage holin | - |
| SE087_RS05705 (SE087_05705) | - | 1146025..1147470 (+) | 1446 | WP_065317035.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15919.35 Da Isoelectric Point: 4.6952
>NTDB_id=902112 SE087_RS05470 WP_319096127.1 1112656..1113081(+) (ssbA) [Staphylococcus aureus strain 17CS1042]
MLNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYQQQGQTQTGNNPFDNTEEDFSDLPF
MLNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYQQQGQTQTGNNPFDNTEEDFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=902112 SE087_RS05470 WP_319096127.1 1112656..1113081(+) (ssbA) [Staphylococcus aureus strain 17CS1042]
ATGCTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAGCGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCAACAACAAGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAG
AAGACTTTTCTGACTTACCGTTCTGA
ATGCTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAGCGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCAACAACAAGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAG
AAGACTTTTCTGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
80.374 |
75.887 |
0.61 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.605 |
100 |
0.589 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
75.177 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.957 |
81.56 |
0.383 |
| ssbA | Streptococcus mutans UA159 |
46.087 |
81.56 |
0.376 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.068 |
83.688 |
0.369 |