NTDB

Overview

Name	ssbB/cilA	Type	Machinery gene
Locus tag	R4705_RS03730	Genome accession	NZ_CP137115
Coordinates	700763..701158 (-)	Length	131 a.a.
NCBI ID	WP_000282467.1	Uniprot ID	A0A098Z0L0
Organism	Streptococcus pneumoniae strain 20614-6
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 695763..706158

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R4705_RS03705	-	696108..696446 (-)	339	WP_001809290.1	helix-turn-helix transcriptional regulator	-
R4705_RS03710	-	696459..697232 (-)	774	WP_000566048.1	class I SAM-dependent methyltransferase	-
R4705_RS03715	-	697678..698433 (-)	756	Protein_713	epoxyqueuosine reductase QueH	-
R4705_RS03720	groL	698571..700193 (-)	1623	WP_000031573.1	chaperonin GroEL	-
R4705_RS03725	groES	700209..700493 (-)	285	WP_000917330.1	co-chaperone GroES	-
R4705_RS03730	ssbB/cilA	700763..701158 (-)	396	WP_000282467.1	single-stranded DNA-binding protein	Machinery gene
R4705_RS03735	-	701235..701996 (-)	762	WP_001107771.1	SDR family oxidoreductase	-
R4705_RS03740	ytpR	702029..702655 (-)	627	WP_000578309.1	YtpR family tRNA-binding protein	-
R4705_RS03745	-	702671..702988 (-)	318	WP_000615767.1	thioredoxin family protein	-
R4705_RS03750	-	702985..703284 (-)	300	WP_001013972.1	DUF4651 domain-containing protein	-
R4705_RS03755	-	703482..703562 (-)	81	WP_223200442.1	hypothetical protein	-
R4705_RS03760	-	703569..703760 (-)	192	WP_000291826.1	cell wall-binding protein	-
R4705_RS03765	-	703921..704595 (-)	675	WP_000725751.1	LiaF transmembrane domain-containing protein	-
R4705_RS03770	-	704601..705047 (-)	447	WP_000776589.1	LytTR family DNA-binding domain-containing protein	-
R4705_RS03775	-	705161..705664 (-)	504	WP_000800942.1	phosphatase PAP2 family protein	-
R4705_RS03780	-	705661..706023 (-)	363	WP_000078806.1	DUF2200 domain-containing protein	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14925.89 Da Isoelectric Point: 5.9409

                                >NTDB_id=896244 R4705_RS03730 WP_000282467.1 700763..701158(-) (ssbB/cilA) [Streptococcus pneumoniae strain 20614-6]

MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR

RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=896244 R4705_RS03730 WP_000282467.1 700763..701158(-) (ssbB/cilA) [Streptococcus pneumoniae strain 20614-6]

ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC

GCGAGCAACTATCGCTGTGAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTCAATATGGTCCTAT

GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT

CGCTTTGAGAAAAATGGCCAAATGAACTACGTGACCGAAGTACTTGTCACAGGATTCCAACTCTTGGAAAGTCGTGCTCA

ACGTGCCATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTAGTCTTGGAAGAGGAAGAATTGCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-101)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A098Z0L0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB/cilA	Streptococcus pneumoniae D39	100	100	1
ssbB/cilA	Streptococcus pneumoniae Rx1	100	100	1
ssbB/cilA	Streptococcus pneumoniae R6	100	100	1
ssbB/cilA	Streptococcus pneumoniae TIGR4	99.237	100	0.992
ssbB/cilA	Streptococcus mitis SK321	98.473	100	0.985
ssbB/cilA	Streptococcus mitis NCTC 12261	98.473	100	0.985
ssbA	Streptococcus mutans UA159	74.809	100	0.748
ssbB	Streptococcus sobrinus strain NIDR 6715-7	70.229	100	0.702
ssbB	Lactococcus lactis subsp. cremoris KW2	59.821	85.496	0.511
ssbA	Bacillus subtilis subsp. subtilis str. 168	50.943	80.916	0.412
ssb	Latilactobacillus sakei subsp. sakei 23K	46.903	86.26	0.405

Detailed information NTG0896244