NTDB

Overview

Name	ssbB/cilA	Type	Machinery gene
Locus tag	R4701_RS07025	Genome accession	NZ_CP137114
Coordinates	1374432..1374827 (+)	Length	131 a.a.
NCBI ID	WP_000282467.1	Uniprot ID	A0A098Z0L0
Organism	Streptococcus pneumoniae strain 15P3054
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 1369432..1379827

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R4701_RS06975	-	1369567..1369929 (+)	363	WP_000078804.1	DUF2200 domain-containing protein	-
R4701_RS06980	-	1369926..1370429 (+)	504	WP_000800943.1	phosphatase PAP2 family protein	-
R4701_RS06985	-	1370543..1370989 (+)	447	WP_000776589.1	LytTR family DNA-binding domain-containing protein	-
R4701_RS06990	-	1370994..1371668 (+)	675	WP_000725719.1	LiaF transmembrane domain-containing protein	-
R4701_RS06995	-	1371829..1372020 (+)	192	WP_000291826.1	cell wall-binding protein	-
R4701_RS07000	-	1372027..1372107 (+)	81	WP_223200442.1	hypothetical protein	-
R4701_RS07005	-	1372305..1372604 (+)	300	WP_001013974.1	DUF4651 domain-containing protein	-
R4701_RS07010	-	1372601..1372918 (+)	318	WP_000615767.1	thioredoxin family protein	-
R4701_RS07015	ytpR	1372934..1373560 (+)	627	WP_000578309.1	YtpR family tRNA-binding protein	-
R4701_RS07020	-	1373593..1374354 (+)	762	WP_001107755.1	SDR family NAD(P)-dependent oxidoreductase	-
R4701_RS07025	ssbB/cilA	1374432..1374827 (+)	396	WP_000282467.1	single-stranded DNA-binding protein	Machinery gene
R4701_RS07030	groES	1374983..1375267 (+)	285	WP_000917304.1	co-chaperone GroES	-
R4701_RS07035	groL	1375283..1376905 (+)	1623	WP_000031573.1	chaperonin GroEL	-
R4701_RS10705	-	1378414..1378620 (+)	207	WP_000775827.1	transcriptional regulator	-
R4701_RS07050	-	1378977..1379510 (-)	534	WP_000775321.1	DUF402 domain-containing protein	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14925.89 Da Isoelectric Point: 5.9409

                                >NTDB_id=896202 R4701_RS07025 WP_000282467.1 1374432..1374827(+) (ssbB/cilA) [Streptococcus pneumoniae strain 15P3054]

MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR

RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=896202 R4701_RS07025 WP_000282467.1 1374432..1374827(+) (ssbB/cilA) [Streptococcus pneumoniae strain 15P3054]

ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC

GCGAGCAACTATCGCTGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTTAATATGGTTCTAT

GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT

CGCTTTGAGAAAAATGGTCAGATGAATTATGTAACCGAAGTCCTTGTGACAGGATTCCAACTCTTGGAAAGTCGTGCCCA

ACGTGCTATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTGGTCTTGGAAGAGGAAGAATTGCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-101)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A098Z0L0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB/cilA	Streptococcus pneumoniae D39	100	100	1
ssbB/cilA	Streptococcus pneumoniae Rx1	100	100	1
ssbB/cilA	Streptococcus pneumoniae R6	100	100	1
ssbB/cilA	Streptococcus pneumoniae TIGR4	99.237	100	0.992
ssbB/cilA	Streptococcus mitis SK321	98.473	100	0.985
ssbB/cilA	Streptococcus mitis NCTC 12261	98.473	100	0.985
ssbA	Streptococcus mutans UA159	74.809	100	0.748
ssbB	Streptococcus sobrinus strain NIDR 6715-7	70.229	100	0.702
ssbB	Lactococcus lactis subsp. cremoris KW2	59.821	85.496	0.511
ssbA	Bacillus subtilis subsp. subtilis str. 168	50.943	80.916	0.412
ssb	Latilactobacillus sakei subsp. sakei 23K	46.903	86.26	0.405

Detailed information NTG0896202