NTDB

Overview

Name	ssbB/cilA	Type	Machinery gene
Locus tag	R4703_RS03840	Genome accession	NZ_CP137100
Coordinates	714302..714697 (-)	Length	131 a.a.
NCBI ID	WP_000282467.1	Uniprot ID	A0A098Z0L0
Organism	Streptococcus pneumoniae strain LYP
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 709302..719697

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R4703_RS03815	-	709448..709981 (+)	534	WP_000775321.1	DUF402 domain-containing protein	-
R4703_RS03820	-	710339..710662 (-)	324	WP_073177330.1	hypothetical protein	-
R4703_RS03825	-	710705..712011 (+)	1307	Protein_740	transposase	-
R4703_RS03830	groL	712110..713732 (-)	1623	WP_000031585.1	chaperonin GroEL	-
R4703_RS03835	groES	713748..714032 (-)	285	WP_000917330.1	co-chaperone GroES	-
R4703_RS03840	ssbB/cilA	714302..714697 (-)	396	WP_000282467.1	single-stranded DNA-binding protein	Machinery gene
R4703_RS03845	-	714775..715536 (-)	762	WP_001107757.1	SDR family oxidoreductase	-
R4703_RS03850	ytpR	715569..716195 (-)	627	WP_000578302.1	YtpR family tRNA-binding protein	-
R4703_RS03855	-	716211..716528 (-)	318	WP_000615774.1	thioredoxin family protein	-
R4703_RS03860	-	716525..716824 (-)	300	WP_001818001.1	DUF4651 domain-containing protein	-
R4703_RS03865	-	716918..717049 (+)	132	WP_001811306.1	hypothetical protein	-
R4703_RS03875	-	717161..717306 (-)	146	Protein_749	cell wall-binding protein	-
R4703_RS03880	-	717518..718192 (-)	675	WP_000725721.1	LiaF transmembrane domain-containing protein	-
R4703_RS03885	-	718197..718643 (-)	447	WP_000776589.1	LytTR family DNA-binding domain-containing protein	-
R4703_RS03890	-	718757..719260 (-)	504	WP_000800939.1	phosphatase PAP2 family protein	-
R4703_RS03895	-	719257..719619 (-)	363	WP_000078801.1	DUF2200 domain-containing protein	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14925.89 Da Isoelectric Point: 5.9409

                                >NTDB_id=895084 R4703_RS03840 WP_000282467.1 714302..714697(-) (ssbB/cilA) [Streptococcus pneumoniae strain LYP]

MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR

RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=895084 R4703_RS03840 WP_000282467.1 714302..714697(-) (ssbB/cilA) [Streptococcus pneumoniae strain LYP]

ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC

GCGAGCAACTATCGCTGTGAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTCAATATGGTCCTAT

GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACTCGT

CGCTTTGAGAAAAATGGCCAAATGAACTACGTGACCGAAGTACTTGTCACAGGATTCCAACTCTTGGAAAGTCGTGCTCA

ACGTGCTATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTGGTCTTGGAAGAGGAAGAATTGCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-101)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A098Z0L0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB/cilA	Streptococcus pneumoniae D39	100	100	1
ssbB/cilA	Streptococcus pneumoniae Rx1	100	100	1
ssbB/cilA	Streptococcus pneumoniae R6	100	100	1
ssbB/cilA	Streptococcus pneumoniae TIGR4	99.237	100	0.992
ssbB/cilA	Streptococcus mitis SK321	98.473	100	0.985
ssbB/cilA	Streptococcus mitis NCTC 12261	98.473	100	0.985
ssbA	Streptococcus mutans UA159	74.809	100	0.748
ssbB	Streptococcus sobrinus strain NIDR 6715-7	70.229	100	0.702
ssbB	Lactococcus lactis subsp. cremoris KW2	59.821	85.496	0.511
ssbA	Bacillus subtilis subsp. subtilis str. 168	50.943	80.916	0.412
ssb	Latilactobacillus sakei subsp. sakei 23K	46.903	86.26	0.405

Detailed information NTG0895084