Detailed information NTG0891829

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: AAEU35_RS08535
• Genome accession: NZ_CP152294
• Coordinates: 1708839..1709135 (+)
• Length: 98 a.a.
• NCBI ID: WP_167593410.1
• Uniprot ID: -
• Organism: Lactococcus lactis strain Q13
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1703839..1714135

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AAEU35_RS08495	-	1704381..1705502 (+)	1122	WP_317141347.1	hypothetical protein	-
AAEU35_RS08500	-	1705502..1705675 (+)	174	WP_096819001.1	hypothetical protein	-
AAEU35_RS08505	-	1705695..1706144 (+)	450	Protein_1628	hypothetical protein	-
AAEU35_RS08510	-	1706989..1707225 (+)	237	WP_317141346.1	hypothetical protein	-
AAEU35_RS08515	-	1707238..1707462 (+)	225	WP_010905920.1	hemolysin XhlA family protein	-
AAEU35_RS08520	-	1707476..1707763 (+)	288	WP_317141345.1	phage holin	-
AAEU35_RS08525	-	1707763..1708542 (+)	780	WP_317141344.1	peptidoglycan amidohydrolase family protein	-
AAEU35_RS08530	-	1708552..1708677 (+)	126	WP_317141343.1	hypothetical protein	-
AAEU35_RS08535	comGC	1708839..1709135 (+)	297	WP_167593410.1	competence type IV pilus major pilin ComGC	Machinery gene
AAEU35_RS08540	comGD	1709167..1709526 (+)	360	WP_023188582.1	competence type IV pilus minor pilin ComGD	Machinery gene
AAEU35_RS08545	comGE	1709498..1709794 (+)	297	WP_058223572.1	competence type IV pilus minor pilin ComGE	Machinery gene
AAEU35_RS08550	comGF	1709757..1710203 (+)	447	WP_029344525.1	competence type IV pilus minor pilin ComGF	Machinery gene
AAEU35_RS08555	comGG	1710242..1710526 (+)	285	WP_025017139.1	competence type IV pilus minor pilin ComGG	Machinery gene
AAEU35_RS08560	-	1710608..1711045 (+)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
AAEU35_RS08565	-	1711042..1711884 (+)	843	WP_015427160.1	metal ABC transporter substrate-binding protein	-
AAEU35_RS08570	-	1712061..1712798 (+)	738	WP_012898617.1	metal ABC transporter ATP-binding protein	-
AAEU35_RS08575	-	1712791..1713600 (+)	810	WP_014570791.1	metal ABC transporter permease	-

Sequence

Protein

• Length: 98 a.a.
• Molecular weight: 11174.83 Da
• Isoelectric Point: 4.2213

>NTDB_id=891829 AAEU35_RS08535 WP_167593410.1 1708839..1709135(+) (comGC) [Lactococcus lactis strain Q13]
MSFLVTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLSELLNAGMITQKQIS
AYDNYYDQNKNEERNFND

Nucleotide

• Length: 297 bp

>NTDB_id=891829 AAEU35_RS08535 WP_167593410.1 1708839..1709135(+) (comGC) [Lactococcus lactis strain Q13]
ATGAGTTTTTTAGTTACCTTAATTGAGATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTGTTCCAAA
TTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTT
ATGAATTAGATCATGATGATGAGAAGCCGAGTCTGTCAGAATTGCTCAACGCTGGGATGATTACTCAAAAACAAATTTCT
GCTTACGATAATTACTATGATCAGAACAAAAATGAAGAACGAAATTTTAATGACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	89.247	94.898	0.847
comGC/cglC	Streptococcus mitis SK321	54.286	100	0.582
comGC	Streptococcus mutans UA140	57.778	91.837	0.531
comGC	Streptococcus mutans UA159	57.778	91.837	0.531
comGC	Streptococcus gordonii str. Challis substr. CH1	58.427	90.816	0.531
comGC/cglC	Streptococcus mitis NCTC 12261	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae Rx1	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae D39	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae R6	55.914	94.898	0.531
comGC/cglC	Streptococcus pneumoniae TIGR4	55.914	94.898	0.531
comGC	Streptococcus suis isolate S10	59.74	78.571	0.469