Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AAEU35_RS08555 Genome accession   NZ_CP152294
Coordinates   1710242..1710526 (+) Length   94 a.a.
NCBI ID   WP_025017139.1    Uniprot ID   -
Organism   Lactococcus lactis strain Q13     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1705242..1715526
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAEU35_RS08500 - 1705502..1705675 (+) 174 WP_096819001.1 hypothetical protein -
  AAEU35_RS08505 - 1705695..1706144 (+) 450 Protein_1628 hypothetical protein -
  AAEU35_RS08510 - 1706989..1707225 (+) 237 WP_317141346.1 hypothetical protein -
  AAEU35_RS08515 - 1707238..1707462 (+) 225 WP_010905920.1 hemolysin XhlA family protein -
  AAEU35_RS08520 - 1707476..1707763 (+) 288 WP_317141345.1 phage holin -
  AAEU35_RS08525 - 1707763..1708542 (+) 780 WP_317141344.1 peptidoglycan amidohydrolase family protein -
  AAEU35_RS08530 - 1708552..1708677 (+) 126 WP_317141343.1 hypothetical protein -
  AAEU35_RS08535 comGC 1708839..1709135 (+) 297 WP_167593410.1 competence type IV pilus major pilin ComGC Machinery gene
  AAEU35_RS08540 comGD 1709167..1709526 (+) 360 WP_023188582.1 competence type IV pilus minor pilin ComGD Machinery gene
  AAEU35_RS08545 comGE 1709498..1709794 (+) 297 WP_058223572.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAEU35_RS08550 comGF 1709757..1710203 (+) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  AAEU35_RS08555 comGG 1710242..1710526 (+) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAEU35_RS08560 - 1710608..1711045 (+) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  AAEU35_RS08565 - 1711042..1711884 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  AAEU35_RS08570 - 1712061..1712798 (+) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  AAEU35_RS08575 - 1712791..1713600 (+) 810 WP_014570791.1 metal ABC transporter permease -
  AAEU35_RS08580 - 1713638..1714504 (-) 867 WP_058204413.1 RluA family pseudouridine synthase -
  AAEU35_RS08585 - 1714708..1715085 (+) 378 WP_180259833.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10813.05 Da        Isoelectric Point: 5.0604

>NTDB_id=891833 AAEU35_RS08555 WP_025017139.1 1710242..1710526(+) (comGG) [Lactococcus lactis strain Q13]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=891833 AAEU35_RS08555 WP_025017139.1 1710242..1710526(+) (comGG) [Lactococcus lactis strain Q13]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585