NTDB

Overview

Name	ssbB/cilA	Type	Machinery gene
Locus tag	RRU92_RS04785	Genome accession	NZ_CP135436
Coordinates	963930..964325 (+)	Length	131 a.a.
NCBI ID	WP_000282453.1	Uniprot ID	I2J174
Organism	Streptococcus sp. DTU_2020_1001019_1_SI_AUS_MUR_006
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 958930..969325

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RRU92_RS04745 (RRU92_04745)	-	959394..959576 (+)	183	WP_315640813.1	hypothetical protein	-
RRU92_RS04750 (RRU92_04750)	-	959904..960137 (+)	234	WP_000368732.1	DUF1858 domain-containing protein	-
RRU92_RS04755 (RRU92_04755)	-	960137..961471 (+)	1335	WP_315640814.1	DUF438 domain-containing protein	-
RRU92_RS04760 (RRU92_04760)	-	961481..961735 (+)	255	WP_060955310.1	DUF1912 family protein	-
RRU92_RS04765 (RRU92_04765)	-	961812..962102 (+)	291	WP_024053819.1	DUF4651 domain-containing protein	-
RRU92_RS04770 (RRU92_04770)	-	962099..962416 (+)	318	WP_315640815.1	thioredoxin family protein	-
RRU92_RS04775 (RRU92_04775)	ytpR	962426..963052 (+)	627	WP_315640816.1	YtpR family tRNA-binding protein	-
RRU92_RS04780 (RRU92_04780)	-	963094..963855 (+)	762	WP_315640817.1	SDR family NAD(P)-dependent oxidoreductase	-
RRU92_RS04785 (RRU92_04785)	ssbB/cilA	963930..964325 (+)	396	WP_000282453.1	single-stranded DNA-binding protein	Machinery gene
RRU92_RS04790 (RRU92_04790)	-	964514..965497 (+)	984	WP_248034687.1	substrate-binding domain-containing protein	-
RRU92_RS04795 (RRU92_04795)	-	965497..966813 (+)	1317	WP_001224944.1	sensor histidine kinase	-
RRU92_RS04800 (RRU92_04800)	-	966820..967503 (+)	684	WP_006147185.1	response regulator transcription factor	-
RRU92_RS04805 (RRU92_04805)	-	967500..968798 (+)	1299	WP_248034686.1	extracellular solute-binding protein	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14797.69 Da Isoelectric Point: 5.9381

                                >NTDB_id=886539 RRU92_RS04785 WP_000282453.1 963930..964325(+) (ssbB/cilA) [Streptococcus sp. DTU_2020_1001019_1_SI_AUS_MUR_006]

MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFINIVVWGKLAETLASYGSKGSLISVDGELRTR

KFEKNGQTNYVTEVLCTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=886539 RRU92_RS04785 WP_000282453.1 963930..964325(+) (ssbB/cilA) [Streptococcus sp. DTU_2020_1001019_1_SI_AUS_MUR_006]

ATGTATAATAAAGTTATTATGATCGGACGTTTGACGTCTACACCAGAGTTGCACAAAACCAACAATGATAAGTCTGTTGC

ACGAGCAACTATCGCAGTGAATCGCCGTTATAAAGATCAAAATGGGGAACGTGAAGCAGACTTCATCAATATTGTGGTCT

GGGGAAAATTGGCTGAAACCTTGGCTAGTTATGGAAGCAAGGGTAGTCTCATTTCTGTGGATGGGGAACTTCGTACCCGT

AAGTTTGAGAAGAATGGCCAGACCAACTATGTAACAGAAGTTCTCTGTACAGGTTTCCAACTCTTAGAAAGCCGTGCCCA

ACGTGCTATGCGTGAAAATAATGCAGGACAAGACTTAGCAGATTTGGTCTTGGAAGAAGAGGAACTTCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-101)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	I2J174

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB/cilA	Streptococcus mitis NCTC 12261	93.13	100	0.931
ssbB/cilA	Streptococcus pneumoniae Rx1	93.13	100	0.931
ssbB/cilA	Streptococcus pneumoniae D39	93.13	100	0.931
ssbB/cilA	Streptococcus pneumoniae R6	93.13	100	0.931
ssbB/cilA	Streptococcus pneumoniae TIGR4	92.366	100	0.924
ssbB/cilA	Streptococcus mitis SK321	91.603	100	0.916
ssbA	Streptococcus mutans UA159	75.573	100	0.756
ssbB	Streptococcus sobrinus strain NIDR 6715-7	70.229	100	0.702
ssbB	Lactococcus lactis subsp. cremoris KW2	60.714	85.496	0.519
ssb	Latilactobacillus sakei subsp. sakei 23K	47.788	86.26	0.412
ssbA	Bacillus subtilis subsp. subtilis str. 168	50.943	80.916	0.412

Detailed information NTG0886539