Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RIM75_RS09705 | Genome accession | NZ_CP133957 |
| Coordinates | 2044689..2045084 (-) | Length | 131 a.a. |
| NCBI ID | WP_012678670.1 | Uniprot ID | A0A7Z9D3W7 |
| Organism | Streptococcus equi subsp. equi strain HT1112 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2030109..2066117 | 2044689..2045084 | within | 0 |
Gene organization within MGE regions
Location: 2030109..2066117
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RIM75_RS09645 (RIM75_09645) | groES | 2031655..2031942 (+) | 288 | WP_012514806.1 | co-chaperone GroES | - |
| RIM75_RS09650 (RIM75_09650) | groL | 2032010..2033635 (+) | 1626 | WP_012678897.1 | chaperonin GroEL | - |
| RIM75_RS09655 (RIM75_09655) | - | 2033789..2035131 (+) | 1343 | WP_165626751.1 | IS3 family transposase | - |
| RIM75_RS09660 (RIM75_09660) | - | 2035165..2036340 (+) | 1176 | WP_317582852.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| RIM75_RS09665 (RIM75_09665) | hslO | 2036590..2037462 (+) | 873 | WP_317582853.1 | Hsp33 family molecular chaperone HslO | - |
| RIM75_RS09670 (RIM75_09670) | dusB | 2037449..2038426 (+) | 978 | WP_015898643.1 | tRNA dihydrouridine synthase DusB | - |
| RIM75_RS09675 (RIM75_09675) | - | 2038447..2039088 (+) | 642 | Protein_1839 | deoxynucleoside kinase | - |
| RIM75_RS09680 (RIM75_09680) | - | 2039374..2040378 (+) | 1005 | WP_015898644.1 | hypothetical protein | - |
| RIM75_RS09685 (RIM75_09685) | - | 2040477..2041280 (-) | 804 | WP_015898645.1 | ABC transporter ATP-binding protein | - |
| RIM75_RS09690 (RIM75_09690) | - | 2041289..2042173 (-) | 885 | WP_015898646.1 | ABC transporter permease | - |
| RIM75_RS09695 (RIM75_09695) | - | 2042288..2043250 (-) | 963 | WP_317582854.1 | ABC transporter substrate-binding protein | - |
| RIM75_RS09700 (RIM75_09700) | - | 2043268..2044242 (-) | 975 | WP_015898648.1 | ABC transporter substrate-binding protein | - |
| RIM75_RS09705 (RIM75_09705) | ssbA | 2044689..2045084 (-) | 396 | WP_012678670.1 | single-stranded DNA-binding protein | Machinery gene |
| RIM75_RS09710 (RIM75_09710) | - | 2045196..2045909 (+) | 714 | WP_015898649.1 | bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG | - |
| RIM75_RS09715 (RIM75_09715) | ytpR | 2046212..2046838 (-) | 627 | WP_015898650.1 | YtpR family tRNA-binding protein | - |
| RIM75_RS09720 (RIM75_09720) | - | 2046853..2047170 (-) | 318 | WP_015898651.1 | thioredoxin family protein | - |
| RIM75_RS09725 (RIM75_09725) | - | 2047167..2047451 (-) | 285 | WP_279526906.1 | DUF4651 domain-containing protein | - |
| RIM75_RS09730 (RIM75_09730) | pepA | 2047859..2048926 (+) | 1068 | WP_015898653.1 | glutamyl aminopeptidase | - |
| RIM75_RS09735 (RIM75_09735) | proC | 2049010..2049783 (+) | 774 | WP_015898654.1 | pyrroline-5-carboxylate reductase | - |
| RIM75_RS09740 (RIM75_09740) | - | 2050006..2050443 (-) | 438 | WP_015898655.1 | hypothetical protein | - |
| RIM75_RS09745 (RIM75_09745) | - | 2050473..2051147 (-) | 675 | WP_012678678.1 | CPBP family intramembrane glutamic endopeptidase | - |
| RIM75_RS09750 (RIM75_09750) | - | 2051157..2051609 (-) | 453 | WP_317582855.1 | DNA-binding protein | - |
| RIM75_RS09755 (RIM75_09755) | - | 2051611..2051814 (-) | 204 | WP_012516427.1 | helix-turn-helix transcriptional regulator | - |
| RIM75_RS09760 (RIM75_09760) | yaaA | 2052256..2052987 (+) | 732 | WP_015898656.1 | peroxide stress protein YaaA | - |
| RIM75_RS09765 (RIM75_09765) | nrdG | 2053445..2054059 (-) | 615 | WP_012678681.1 | anaerobic ribonucleoside-triphosphate reductase activating protein | - |
| RIM75_RS09770 (RIM75_09770) | - | 2054069..2054563 (-) | 495 | WP_012516431.1 | GNAT family N-acetyltransferase | - |
| RIM75_RS09775 (RIM75_09775) | - | 2054576..2055511 (-) | 936 | WP_317582856.1 | Gfo/Idh/MocA family oxidoreductase | - |
| RIM75_RS09780 (RIM75_09780) | - | 2055539..2055685 (-) | 147 | WP_012516433.1 | hypothetical protein | - |
| RIM75_RS09785 (RIM75_09785) | nrdD | 2055791..2057989 (-) | 2199 | WP_015898658.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| RIM75_RS09790 (RIM75_09790) | - | 2058086..2059645 (-) | 1560 | WP_015898659.1 | membrane protein | - |
| RIM75_RS09795 (RIM75_09795) | - | 2060193..2060492 (-) | 300 | WP_012516437.1 | DUF1292 domain-containing protein | - |
| RIM75_RS09800 (RIM75_09800) | ruvX | 2060502..2060921 (-) | 420 | WP_015898660.1 | Holliday junction resolvase RuvX | - |
| RIM75_RS09805 (RIM75_09805) | - | 2060918..2061187 (-) | 270 | WP_012516439.1 | IreB family regulatory phosphoprotein | - |
| RIM75_RS09810 (RIM75_09810) | spx | 2061300..2061698 (-) | 399 | WP_012516440.1 | transcriptional regulator Spx | - |
| RIM75_RS09815 (RIM75_09815) | recA | 2062074..2063210 (-) | 1137 | WP_012678688.1 | recombinase RecA | Machinery gene |
| RIM75_RS09820 (RIM75_09820) | cinA | 2063304..2064575 (-) | 1272 | WP_015898661.1 | competence/damage-inducible protein A | Machinery gene |
| RIM75_RS09825 (RIM75_09825) | - | 2065261..2065551 (-) | 291 | WP_012516443.1 | hypothetical protein | - |
| RIM75_RS09830 (RIM75_09830) | - | 2065545..2066117 (-) | 573 | WP_015898662.1 | phospholipase A2 SlaB | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14768.92 Da Isoelectric Point: 8.9315
>NTDB_id=877993 RIM75_RS09705 WP_012678670.1 2044689..2045084(-) (ssbA) [Streptococcus equi subsp. equi strain HT1112]
MYNKVILIGRLVAKPELNKTLTDKQVVRFTLAVNRRFKTTTGEREVDFINAVAWGGLAETLASYASKGSLLSLDGELRTR
KYDKAGQTHFVTEVLCHSFQLLESRAQRAIRENNAANDLIDLALEEEKLPF
MYNKVILIGRLVAKPELNKTLTDKQVVRFTLAVNRRFKTTTGEREVDFINAVAWGGLAETLASYASKGSLLSLDGELRTR
KYDKAGQTHFVTEVLCHSFQLLESRAQRAIRENNAANDLIDLALEEEKLPF
Nucleotide
Download Length: 396 bp
>NTDB_id=877993 RIM75_RS09705 WP_012678670.1 2044689..2045084(-) (ssbA) [Streptococcus equi subsp. equi strain HT1112]
ATGTACAATAAAGTAATCTTGATAGGCCGTTTAGTGGCCAAGCCAGAATTAAACAAGACATTAACGGATAAGCAGGTCGT
TCGATTTACCTTAGCAGTTAATCGTCGGTTTAAGACGACGACTGGTGAGCGTGAGGTGGATTTTATCAATGCTGTTGCTT
GGGGAGGTTTGGCTGAAACCTTGGCTTCCTATGCTAGCAAGGGGAGTCTGCTGTCACTTGATGGCGAGCTTCGCACACGA
AAATATGACAAGGCGGGTCAGACTCATTTTGTGACAGAGGTTTTGTGTCATTCTTTTCAATTGCTGGAAAGTCGAGCGCA
ACGAGCTATACGTGAAAACAACGCTGCTAATGATTTGATTGATTTGGCTTTAGAGGAGGAAAAGCTTCCCTTTTAA
ATGTACAATAAAGTAATCTTGATAGGCCGTTTAGTGGCCAAGCCAGAATTAAACAAGACATTAACGGATAAGCAGGTCGT
TCGATTTACCTTAGCAGTTAATCGTCGGTTTAAGACGACGACTGGTGAGCGTGAGGTGGATTTTATCAATGCTGTTGCTT
GGGGAGGTTTGGCTGAAACCTTGGCTTCCTATGCTAGCAAGGGGAGTCTGCTGTCACTTGATGGCGAGCTTCGCACACGA
AAATATGACAAGGCGGGTCAGACTCATTTTGTGACAGAGGTTTTGTGTCATTCTTTTCAATTGCTGGAAAGTCGAGCGCA
ACGAGCTATACGTGAAAACAACGCTGCTAATGATTTGATTGATTTGGCTTTAGAGGAGGAAAAGCTTCCCTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
76.336 |
100 |
0.763 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
71.756 |
100 |
0.718 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
70.992 |
100 |
0.71 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus mitis SK321 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
69.466 |
100 |
0.695 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
59.821 |
85.496 |
0.511 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
44.444 |
89.313 |
0.397 |