Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RIM73_RS09930 | Genome accession | NZ_CP133956 |
| Coordinates | 2079293..2079688 (-) | Length | 131 a.a. |
| NCBI ID | WP_012678670.1 | Uniprot ID | A0A7Z9D3W7 |
| Organism | Streptococcus equi subsp. equi strain HTP232 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2064713..2100721 | 2079293..2079688 | within | 0 |
Gene organization within MGE regions
Location: 2064713..2100721
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RIM73_RS09870 (RIM73_09870) | groES | 2066259..2066546 (+) | 288 | WP_012514806.1 | co-chaperone GroES | - |
| RIM73_RS09875 (RIM73_09875) | groL | 2066614..2068239 (+) | 1626 | WP_012678897.1 | chaperonin GroEL | - |
| RIM73_RS09880 (RIM73_09880) | - | 2068393..2069735 (+) | 1343 | WP_165626751.1 | IS3 family transposase | - |
| RIM73_RS09885 (RIM73_09885) | - | 2069769..2070944 (+) | 1176 | WP_317582852.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| RIM73_RS09890 (RIM73_09890) | hslO | 2071194..2072066 (+) | 873 | WP_317582853.1 | Hsp33 family molecular chaperone HslO | - |
| RIM73_RS09895 (RIM73_09895) | dusB | 2072053..2073030 (+) | 978 | WP_015898643.1 | tRNA dihydrouridine synthase DusB | - |
| RIM73_RS09900 (RIM73_09900) | - | 2073051..2073692 (+) | 642 | Protein_1896 | deoxynucleoside kinase | - |
| RIM73_RS09905 (RIM73_09905) | - | 2073978..2074982 (+) | 1005 | WP_015898644.1 | hypothetical protein | - |
| RIM73_RS09910 (RIM73_09910) | - | 2075081..2075884 (-) | 804 | WP_015898645.1 | ABC transporter ATP-binding protein | - |
| RIM73_RS09915 (RIM73_09915) | - | 2075893..2076777 (-) | 885 | WP_015898646.1 | ABC transporter permease | - |
| RIM73_RS09920 (RIM73_09920) | - | 2076892..2077854 (-) | 963 | WP_317582854.1 | ABC transporter substrate-binding protein | - |
| RIM73_RS09925 (RIM73_09925) | - | 2077872..2078846 (-) | 975 | WP_015898648.1 | ABC transporter substrate-binding protein | - |
| RIM73_RS09930 (RIM73_09930) | ssbA | 2079293..2079688 (-) | 396 | WP_012678670.1 | single-stranded DNA-binding protein | Machinery gene |
| RIM73_RS09935 (RIM73_09935) | - | 2079800..2080513 (+) | 714 | WP_015898649.1 | bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG | - |
| RIM73_RS09940 (RIM73_09940) | ytpR | 2080816..2081442 (-) | 627 | WP_015898650.1 | YtpR family tRNA-binding protein | - |
| RIM73_RS09945 (RIM73_09945) | - | 2081457..2081774 (-) | 318 | WP_015898651.1 | thioredoxin family protein | - |
| RIM73_RS09950 (RIM73_09950) | - | 2081771..2082055 (-) | 285 | WP_279526906.1 | DUF4651 domain-containing protein | - |
| RIM73_RS09955 (RIM73_09955) | pepA | 2082463..2083530 (+) | 1068 | WP_015898653.1 | glutamyl aminopeptidase | - |
| RIM73_RS09960 (RIM73_09960) | proC | 2083614..2084387 (+) | 774 | WP_015898654.1 | pyrroline-5-carboxylate reductase | - |
| RIM73_RS09965 (RIM73_09965) | - | 2084610..2085047 (-) | 438 | WP_015898655.1 | hypothetical protein | - |
| RIM73_RS09970 (RIM73_09970) | - | 2085077..2085751 (-) | 675 | WP_012678678.1 | CPBP family intramembrane glutamic endopeptidase | - |
| RIM73_RS09975 (RIM73_09975) | - | 2085761..2086213 (-) | 453 | WP_317582855.1 | DNA-binding protein | - |
| RIM73_RS09980 (RIM73_09980) | - | 2086215..2086418 (-) | 204 | WP_012516427.1 | helix-turn-helix transcriptional regulator | - |
| RIM73_RS09985 (RIM73_09985) | yaaA | 2086860..2087591 (+) | 732 | WP_015898656.1 | peroxide stress protein YaaA | - |
| RIM73_RS09990 (RIM73_09990) | nrdG | 2088049..2088663 (-) | 615 | WP_317583075.1 | anaerobic ribonucleoside-triphosphate reductase activating protein | - |
| RIM73_RS09995 (RIM73_09995) | - | 2088673..2089167 (-) | 495 | WP_012516431.1 | GNAT family N-acetyltransferase | - |
| RIM73_RS10000 (RIM73_10000) | - | 2089180..2090115 (-) | 936 | WP_317582856.1 | Gfo/Idh/MocA family oxidoreductase | - |
| RIM73_RS10005 (RIM73_10005) | - | 2090143..2090289 (-) | 147 | WP_012516433.1 | hypothetical protein | - |
| RIM73_RS10010 (RIM73_10010) | nrdD | 2090395..2092593 (-) | 2199 | WP_015898658.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| RIM73_RS10015 (RIM73_10015) | - | 2092690..2094249 (-) | 1560 | WP_015898659.1 | membrane protein | - |
| RIM73_RS10020 (RIM73_10020) | - | 2094797..2095096 (-) | 300 | WP_012516437.1 | DUF1292 domain-containing protein | - |
| RIM73_RS10025 (RIM73_10025) | ruvX | 2095106..2095525 (-) | 420 | WP_015898660.1 | Holliday junction resolvase RuvX | - |
| RIM73_RS10030 (RIM73_10030) | - | 2095522..2095791 (-) | 270 | WP_012516439.1 | IreB family regulatory phosphoprotein | - |
| RIM73_RS10035 (RIM73_10035) | spx | 2095904..2096302 (-) | 399 | WP_012516440.1 | transcriptional regulator Spx | - |
| RIM73_RS10040 (RIM73_10040) | recA | 2096678..2097814 (-) | 1137 | WP_012678688.1 | recombinase RecA | Machinery gene |
| RIM73_RS10045 (RIM73_10045) | cinA | 2097908..2099179 (-) | 1272 | WP_015898661.1 | competence/damage-inducible protein A | Machinery gene |
| RIM73_RS10050 (RIM73_10050) | - | 2099865..2100155 (-) | 291 | WP_012516443.1 | hypothetical protein | - |
| RIM73_RS10055 (RIM73_10055) | - | 2100149..2100721 (-) | 573 | WP_015898662.1 | phospholipase A2 SlaB | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14768.92 Da Isoelectric Point: 8.9315
>NTDB_id=877939 RIM73_RS09930 WP_012678670.1 2079293..2079688(-) (ssbA) [Streptococcus equi subsp. equi strain HTP232]
MYNKVILIGRLVAKPELNKTLTDKQVVRFTLAVNRRFKTTTGEREVDFINAVAWGGLAETLASYASKGSLLSLDGELRTR
KYDKAGQTHFVTEVLCHSFQLLESRAQRAIRENNAANDLIDLALEEEKLPF
MYNKVILIGRLVAKPELNKTLTDKQVVRFTLAVNRRFKTTTGEREVDFINAVAWGGLAETLASYASKGSLLSLDGELRTR
KYDKAGQTHFVTEVLCHSFQLLESRAQRAIRENNAANDLIDLALEEEKLPF
Nucleotide
Download Length: 396 bp
>NTDB_id=877939 RIM73_RS09930 WP_012678670.1 2079293..2079688(-) (ssbA) [Streptococcus equi subsp. equi strain HTP232]
ATGTACAATAAAGTAATCTTGATAGGCCGTTTAGTGGCCAAGCCAGAATTAAACAAGACATTAACGGATAAGCAGGTCGT
TCGATTTACCTTAGCAGTTAATCGTCGGTTTAAGACGACGACTGGTGAGCGTGAGGTGGATTTTATCAATGCTGTTGCTT
GGGGAGGTTTGGCTGAAACCTTGGCTTCCTATGCTAGCAAGGGGAGTCTGCTGTCACTTGATGGCGAGCTTCGCACACGA
AAATATGACAAGGCGGGTCAGACTCATTTTGTGACAGAGGTTTTGTGTCATTCTTTTCAATTGCTGGAAAGTCGAGCGCA
ACGAGCTATACGTGAAAACAACGCTGCTAATGATTTGATTGATTTGGCTTTAGAGGAGGAAAAGCTTCCCTTTTAA
ATGTACAATAAAGTAATCTTGATAGGCCGTTTAGTGGCCAAGCCAGAATTAAACAAGACATTAACGGATAAGCAGGTCGT
TCGATTTACCTTAGCAGTTAATCGTCGGTTTAAGACGACGACTGGTGAGCGTGAGGTGGATTTTATCAATGCTGTTGCTT
GGGGAGGTTTGGCTGAAACCTTGGCTTCCTATGCTAGCAAGGGGAGTCTGCTGTCACTTGATGGCGAGCTTCGCACACGA
AAATATGACAAGGCGGGTCAGACTCATTTTGTGACAGAGGTTTTGTGTCATTCTTTTCAATTGCTGGAAAGTCGAGCGCA
ACGAGCTATACGTGAAAACAACGCTGCTAATGATTTGATTGATTTGGCTTTAGAGGAGGAAAAGCTTCCCTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
76.336 |
100 |
0.763 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
71.756 |
100 |
0.718 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
70.992 |
100 |
0.71 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus mitis SK321 |
70.229 |
100 |
0.702 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
69.466 |
100 |
0.695 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
59.821 |
85.496 |
0.511 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
44.444 |
89.313 |
0.397 |