Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | RDJ18_RS07355 | Genome accession | NZ_CP133442 |
| Coordinates | 1422551..1422862 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain SA191 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1417551..1427862
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RDJ18_RS07325 (RDJ18_07325) | - | 1418334..1418537 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| RDJ18_RS07330 (RDJ18_07330) | - | 1418534..1419520 (+) | 987 | WP_000161313.1 | ROK family glucokinase | - |
| RDJ18_RS07335 (RDJ18_07335) | - | 1419520..1419849 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| RDJ18_RS07340 (RDJ18_07340) | - | 1419846..1420469 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| RDJ18_RS07345 (RDJ18_07345) | comGA | 1420521..1421495 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| RDJ18_RS07350 (RDJ18_07350) | comGB | 1421467..1422537 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| RDJ18_RS07355 (RDJ18_07355) | comGC | 1422551..1422862 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| RDJ18_RS07360 (RDJ18_07360) | comGD | 1422840..1423286 (+) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| RDJ18_RS07365 (RDJ18_07365) | comGE | 1423273..1423572 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| RDJ18_RS07370 (RDJ18_07370) | comGF | 1423490..1423987 (+) | 498 | WP_001803317.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| RDJ18_RS07375 (RDJ18_07375) | - | 1424084..1424230 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| RDJ18_RS07380 (RDJ18_07380) | - | 1424220..1424744 (+) | 525 | WP_001015118.1 | shikimate kinase | - |
| RDJ18_RS07385 (RDJ18_07385) | gcvT | 1424903..1425994 (+) | 1092 | WP_000093351.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RDJ18_RS07390 (RDJ18_07390) | gcvPA | 1426014..1427360 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=874134 RDJ18_RS07355 WP_000472256.1 1422551..1422862(+) (comGC) [Staphylococcus aureus strain SA191]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=874134 RDJ18_RS07355 WP_000472256.1 1422551..1422862(+) (comGC) [Staphylococcus aureus strain SA191]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |