Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RDJ18_RS01605 | Genome accession | NZ_CP133442 |
| Coordinates | 351573..351998 (+) | Length | 141 a.a. |
| NCBI ID | WP_000934780.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain SA191 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 340446..382435 | 351573..351998 | within | 0 |
Gene organization within MGE regions
Location: 340446..382435
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RDJ18_RS01495 (RDJ18_01495) | - | 340446..341651 (-) | 1206 | WP_309042846.1 | tyrosine-type recombinase/integrase | - |
| RDJ18_RS01500 (RDJ18_01500) | - | 341777..341956 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| RDJ18_RS01505 (RDJ18_01505) | - | 341936..342868 (-) | 933 | WP_000392186.1 | hypothetical protein | - |
| RDJ18_RS01510 (RDJ18_01510) | - | 343008..343175 (-) | 168 | WP_000705247.1 | hypothetical protein | - |
| RDJ18_RS01515 (RDJ18_01515) | - | 343377..344006 (-) | 630 | WP_029549401.1 | LexA family transcriptional regulator | - |
| RDJ18_RS01520 (RDJ18_01520) | - | 344160..344387 (+) | 228 | WP_015978369.1 | helix-turn-helix transcriptional regulator | - |
| RDJ18_RS01525 (RDJ18_01525) | - | 344410..345186 (+) | 777 | WP_029549402.1 | Rha family transcriptional regulator | - |
| RDJ18_RS01530 (RDJ18_01530) | - | 345215..345418 (+) | 204 | WP_000394020.1 | hypothetical protein | - |
| RDJ18_RS01535 (RDJ18_01535) | - | 345415..345549 (-) | 135 | WP_001119050.1 | hypothetical protein | - |
| RDJ18_RS01540 (RDJ18_01540) | - | 345606..346394 (+) | 789 | WP_031862674.1 | phage antirepressor KilAC domain-containing protein | - |
| RDJ18_RS01545 (RDJ18_01545) | - | 346411..346605 (+) | 195 | WP_000390105.1 | hypothetical protein | - |
| RDJ18_RS01550 (RDJ18_01550) | - | 346659..347411 (+) | 753 | WP_001148595.1 | phage antirepressor KilAC domain-containing protein | - |
| RDJ18_RS01555 (RDJ18_01555) | - | 347424..347684 (+) | 261 | WP_000435343.1 | hypothetical protein | - |
| RDJ18_RS01560 (RDJ18_01560) | - | 347708..347863 (-) | 156 | Protein_309 | hypothetical protein | - |
| RDJ18_RS01565 (RDJ18_01565) | - | 347918..348157 (+) | 240 | WP_001294156.1 | hypothetical protein | - |
| RDJ18_RS01570 (RDJ18_01570) | - | 348485..349198 (+) | 714 | WP_114304731.1 | BRO family protein | - |
| RDJ18_RS01575 (RDJ18_01575) | - | 349362..349592 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| RDJ18_RS01580 (RDJ18_01580) | - | 349651..349914 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| RDJ18_RS01585 (RDJ18_01585) | - | 349926..350087 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| RDJ18_RS01590 (RDJ18_01590) | - | 350181..350441 (+) | 261 | WP_000291077.1 | DUF1108 family protein | - |
| RDJ18_RS01595 (RDJ18_01595) | - | 350456..350935 (+) | 480 | WP_000002510.1 | siphovirus Gp157 family protein | - |
| RDJ18_RS01600 (RDJ18_01600) | - | 350935..351573 (+) | 639 | WP_001043065.1 | ERF family protein | - |
| RDJ18_RS01605 (RDJ18_01605) | ssbA | 351573..351998 (+) | 426 | WP_000934780.1 | single-stranded DNA-binding protein | Machinery gene |
| RDJ18_RS01610 (RDJ18_01610) | - | 352012..352686 (+) | 675 | WP_001121804.1 | putative HNHc nuclease | - |
| RDJ18_RS01615 (RDJ18_01615) | - | 352768..353523 (-) | 756 | WP_000276234.1 | hypothetical protein | - |
| RDJ18_RS01620 (RDJ18_01620) | - | 353588..354358 (+) | 771 | WP_000190252.1 | conserved phage C-terminal domain-containing protein | - |
| RDJ18_RS01625 (RDJ18_01625) | - | 354369..355142 (+) | 774 | WP_000803053.1 | ATP-binding protein | - |
| RDJ18_RS01630 (RDJ18_01630) | - | 355136..355297 (+) | 162 | WP_000237153.1 | hypothetical protein | - |
| RDJ18_RS01635 (RDJ18_01635) | - | 355310..355531 (+) | 222 | WP_001123679.1 | DUF3269 family protein | - |
| RDJ18_RS01640 (RDJ18_01640) | - | 355541..355945 (+) | 405 | WP_000049807.1 | DUF1064 domain-containing protein | - |
| RDJ18_RS01645 (RDJ18_01645) | - | 355950..356135 (+) | 186 | WP_001187254.1 | DUF3113 family protein | - |
| RDJ18_RS01650 (RDJ18_01650) | - | 356136..356498 (+) | 363 | WP_000536054.1 | SA1788 family PVL leukocidin-associated protein | - |
| RDJ18_RS01655 (RDJ18_01655) | - | 356498..356752 (+) | 255 | WP_000111495.1 | DUF3310 domain-containing protein | - |
| RDJ18_RS01660 (RDJ18_01660) | - | 356758..357000 (+) | 243 | WP_001838261.1 | phi PVL orf 51-like protein | - |
| RDJ18_RS01665 (RDJ18_01665) | - | 357013..357414 (+) | 402 | WP_000695762.1 | hypothetical protein | - |
| RDJ18_RS01670 (RDJ18_01670) | - | 357411..357695 (+) | 285 | WP_001105618.1 | hypothetical protein | - |
| RDJ18_RS01675 (RDJ18_01675) | - | 357688..357813 (+) | 126 | Protein_332 | DUF1024 family protein | - |
| RDJ18_RS01680 (RDJ18_01680) | - | 358170..358580 (+) | 411 | WP_000197967.1 | hypothetical protein | - |
| RDJ18_RS01685 (RDJ18_01685) | - | 358573..359109 (+) | 537 | WP_001066452.1 | dUTPase | - |
| RDJ18_RS01690 (RDJ18_01690) | - | 359146..359391 (+) | 246 | WP_001282073.1 | hypothetical protein | - |
| RDJ18_RS01695 (RDJ18_01695) | - | 359388..359594 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| RDJ18_RS01700 (RDJ18_01700) | rinB | 359591..359740 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| RDJ18_RS01705 (RDJ18_01705) | - | 359899..360549 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| RDJ18_RS01710 (RDJ18_01710) | - | 360549..360749 (+) | 201 | WP_309042854.1 | DUF1514 family protein | - |
| RDJ18_RS01715 (RDJ18_01715) | - | 360777..361193 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| RDJ18_RS01720 (RDJ18_01720) | - | 361425..361724 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| RDJ18_RS01725 (RDJ18_01725) | - | 361855..362199 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| RDJ18_RS01730 (RDJ18_01730) | - | 362196..363857 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| RDJ18_RS01735 (RDJ18_01735) | - | 363873..365060 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| RDJ18_RS01740 (RDJ18_01740) | - | 365044..365781 (+) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| RDJ18_RS01745 (RDJ18_01745) | - | 365805..366950 (+) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| RDJ18_RS01750 (RDJ18_01750) | - | 366970..367254 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| RDJ18_RS01755 (RDJ18_01755) | - | 367244..367528 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| RDJ18_RS01760 (RDJ18_01760) | - | 367512..367874 (+) | 363 | WP_000755147.1 | head-tail adaptor protein | - |
| RDJ18_RS01765 (RDJ18_01765) | - | 367871..368275 (+) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| RDJ18_RS01770 (RDJ18_01770) | - | 368272..368679 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| RDJ18_RS01775 (RDJ18_01775) | - | 368680..369324 (+) | 645 | WP_000268741.1 | major tail protein | - |
| RDJ18_RS01780 (RDJ18_01780) | - | 369378..369590 (+) | 213 | WP_230402383.1 | Ig-like domain-containing protein | - |
| RDJ18_RS01785 (RDJ18_01785) | gpG | 369640..369990 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| RDJ18_RS01790 (RDJ18_01790) | gpGT | 370041..370178 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| RDJ18_RS01795 (RDJ18_01795) | - | 370235..374764 (+) | 4530 | WP_001795393.1 | phage tail tape measure protein | - |
| RDJ18_RS01800 (RDJ18_01800) | - | 374761..376245 (+) | 1485 | WP_000567405.1 | phage tail domain-containing protein | - |
| RDJ18_RS01805 (RDJ18_01805) | - | 376261..380043 (+) | 3783 | WP_000582173.1 | phage tail spike protein | - |
| RDJ18_RS01810 (RDJ18_01810) | - | 380036..380188 (+) | 153 | WP_001000058.1 | hypothetical protein | - |
| RDJ18_RS01815 (RDJ18_01815) | - | 380235..380522 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| RDJ18_RS01820 (RDJ18_01820) | - | 380580..380876 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| RDJ18_RS01825 (RDJ18_01825) | pepG1 | 381068..381202 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| RDJ18_RS01830 (RDJ18_01830) | - | 381255..381362 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| RDJ18_RS01835 (RDJ18_01835) | - | 381414..381668 (+) | 255 | WP_000611512.1 | phage holin | - |
| RDJ18_RS01840 (RDJ18_01840) | - | 381680..382435 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15847.32 Da Isoelectric Point: 4.6952
>NTDB_id=874112 RDJ18_RS01605 WP_000934780.1 351573..351998(+) (ssbA) [Staphylococcus aureus strain SA191]
MLNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNSNQQQNDNYQQQGQAQTGNNPFDNTEEDFSDLPF
MLNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNSNQQQNDNYQQQGQAQTGNNPFDNTEEDFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=874112 RDJ18_RS01605 WP_000934780.1 351573..351998(+) (ssbA) [Staphylococcus aureus strain SA191]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAGCGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACAAAATGACAATTATCAACAACAAGGACAAGCTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAGCGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACAAAATGACAATTATCAACAACAAGGACAAGCTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
80.374 |
75.887 |
0.61 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.632 |
100 |
0.567 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
75.177 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.068 |
83.688 |
0.369 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
45.217 |
81.56 |
0.369 |
| ssbA | Streptococcus mutans UA159 |
44.348 |
81.56 |
0.362 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.22 |
83.688 |
0.362 |