Detailed information
Overview
| Name | ssbB | Type | Machinery gene |
| Locus tag | RCG17_RS11885 | Genome accession | NZ_CP133268 |
| Coordinates | 2346958..2347326 (-) | Length | 122 a.a. |
| NCBI ID | WP_308175346.1 | Uniprot ID | - |
| Organism | Neobacillus sp. PS3-12 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 2346782..2369463 | 2346958..2347326 | within | 0 |
Gene organization within MGE regions
Location: 2346782..2369463
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RCG17_RS11880 (RCG17_11880) | - | 2346782..2346961 (-) | 180 | WP_308175345.1 | hypothetical protein | - |
| RCG17_RS11885 (RCG17_11885) | ssbB | 2346958..2347326 (-) | 369 | WP_308175346.1 | single-stranded DNA-binding protein | Machinery gene |
| RCG17_RS11890 (RCG17_11890) | - | 2347608..2348030 (+) | 423 | WP_308175347.1 | YwpF family protein | - |
| RCG17_RS11895 (RCG17_11895) | - | 2348114..2348401 (+) | 288 | WP_308175348.1 | YciI family protein | - |
| RCG17_RS11900 (RCG17_11900) | - | 2348501..2349232 (+) | 732 | WP_308175349.1 | GntR family transcriptional regulator | - |
| RCG17_RS11905 (RCG17_11905) | - | 2349425..2350396 (-) | 972 | WP_308175350.1 | SIS domain-containing protein | - |
| RCG17_RS11910 (RCG17_11910) | - | 2350426..2351256 (-) | 831 | WP_308175351.1 | sugar phosphate isomerase/epimerase family protein | - |
| RCG17_RS11915 (RCG17_11915) | - | 2351270..2352082 (-) | 813 | WP_308175352.1 | fructoselysine 6-kinase | - |
| RCG17_RS11920 (RCG17_11920) | - | 2352095..2352816 (-) | 722 | Protein_2324 | amino acid ABC transporter ATP-binding protein | - |
| RCG17_RS11925 (RCG17_11925) | - | 2352803..2353465 (-) | 663 | WP_308175353.1 | amino acid ABC transporter permease | - |
| RCG17_RS11930 (RCG17_11930) | - | 2353523..2354359 (-) | 837 | WP_308175354.1 | transporter substrate-binding domain-containing protein | - |
| RCG17_RS11935 (RCG17_11935) | fabZ | 2354858..2355296 (-) | 439 | Protein_2327 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
| RCG17_RS28340 | - | 2355468..2356373 (+) | 906 | WP_374120922.1 | lytic transglycosylase domain-containing protein | - |
| RCG17_RS11945 (RCG17_11945) | - | 2356402..2356653 (-) | 252 | WP_308175355.1 | DNA-directed RNA polymerase subunit beta | - |
| RCG17_RS11950 (RCG17_11950) | - | 2356671..2357480 (-) | 810 | WP_308175356.1 | flagellar hook-basal body protein | - |
| RCG17_RS11955 (RCG17_11955) | - | 2357506..2358285 (-) | 780 | WP_308175357.1 | flagellar hook-basal body protein | - |
| RCG17_RS11960 (RCG17_11960) | - | 2358962..2359962 (-) | 1001 | Protein_2332 | rod shape-determining protein | - |
| RCG17_RS11965 (RCG17_11965) | spoIIID | 2360105..2360377 (-) | 273 | WP_308175358.1 | sporulation transcriptional regulator SpoIIID | - |
| RCG17_RS11970 (RCG17_11970) | - | 2360757..2361065 (+) | 309 | WP_308175359.1 | MGMT family protein | - |
| RCG17_RS11975 (RCG17_11975) | - | 2361172..2362794 (-) | 1623 | WP_308175360.1 | mannitol dehydrogenase family protein | - |
| RCG17_RS11980 (RCG17_11980) | - | 2362864..2363061 (+) | 198 | WP_308175361.1 | hypothetical protein | - |
| RCG17_RS11985 (RCG17_11985) | - | 2363457..2365424 (-) | 1968 | WP_308175362.1 | penicillin-binding transpeptidase domain-containing protein | - |
| RCG17_RS11990 (RCG17_11990) | - | 2365774..2366562 (-) | 789 | WP_308175363.1 | M23 family metallopeptidase | - |
| RCG17_RS11995 (RCG17_11995) | - | 2366715..2367710 (-) | 996 | WP_308175364.1 | nuclease-related domain-containing protein | - |
| RCG17_RS12000 (RCG17_12000) | - | 2368190..2368384 (-) | 195 | WP_308175365.1 | hypothetical protein | - |
| RCG17_RS12005 (RCG17_12005) | spoIID | 2368429..2369463 (-) | 1035 | WP_308175366.1 | stage II sporulation protein D | - |
Sequence
Protein
Download Length: 122 a.a. Molecular weight: 13964.86 Da Isoelectric Point: 9.4999
>NTDB_id=873091 RCG17_RS11885 WP_308175346.1 2346958..2347326(-) (ssbB) [Neobacillus sp. PS3-12]
MINQVTIVGRLTRDPEAKVTSEGIPFAHVTLAVNRQYRNQNGEQEADFISCTLWRKAAQNTAQYCRKGSVVGITGRIQTR
HYDTQEGKRIYITEVIADTVRFLSSKPHIETKKQKIEEELPF
MINQVTIVGRLTRDPEAKVTSEGIPFAHVTLAVNRQYRNQNGEQEADFISCTLWRKAAQNTAQYCRKGSVVGITGRIQTR
HYDTQEGKRIYITEVIADTVRFLSSKPHIETKKQKIEEELPF
Nucleotide
Download Length: 369 bp
>NTDB_id=873091 RCG17_RS11885 WP_308175346.1 2346958..2347326(-) (ssbB) [Neobacillus sp. PS3-12]
ATGATCAATCAAGTGACCATTGTCGGAAGATTGACACGTGATCCCGAAGCCAAAGTGACGTCAGAAGGGATCCCCTTCGC
CCATGTAACCTTGGCCGTCAACCGCCAATACCGAAATCAAAACGGTGAACAGGAAGCGGATTTTATCTCTTGCACGCTTT
GGCGCAAAGCCGCTCAAAACACAGCACAATACTGCCGAAAGGGGTCCGTTGTCGGAATTACCGGGAGAATCCAAACCCGC
CATTATGACACGCAGGAAGGCAAACGGATATACATCACCGAAGTGATCGCCGATACCGTTCGCTTTTTGAGCAGCAAACC
GCACATCGAAACGAAGAAACAAAAAATCGAGGAGGAATTGCCATTTTGA
ATGATCAATCAAGTGACCATTGTCGGAAGATTGACACGTGATCCCGAAGCCAAAGTGACGTCAGAAGGGATCCCCTTCGC
CCATGTAACCTTGGCCGTCAACCGCCAATACCGAAATCAAAACGGTGAACAGGAAGCGGATTTTATCTCTTGCACGCTTT
GGCGCAAAGCCGCTCAAAACACAGCACAATACTGCCGAAAGGGGTCCGTTGTCGGAATTACCGGGAGAATCCAAACCCGC
CATTATGACACGCAGGAAGGCAAACGGATATACATCACCGAAGTGATCGCCGATACCGTTCGCTTTTTGAGCAGCAAACC
GCACATCGAAACGAAGAAACAAAAAATCGAGGAGGAATTGCCATTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
62.617 |
87.705 |
0.549 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.558 |
92.623 |
0.459 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.83 |
86.885 |
0.459 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.879 |
100 |
0.41 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.879 |
100 |
0.41 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.121 |
100 |
0.402 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.121 |
100 |
0.402 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.121 |
100 |
0.402 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.121 |
100 |
0.402 |
| ssbB/cilA | Streptococcus mitis SK321 |
36.364 |
100 |
0.393 |
| ssbA | Streptococcus mutans UA159 |
34.848 |
100 |
0.377 |