Detailed information NTG0872858

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: RCG22_RS16690
• Genome accession: NZ_CP133262
• Coordinates: 3442836..3443222 (+)
• Length: 128 a.a.
• NCBI ID: WP_308107188.1
• Uniprot ID: -
• Organism: Neobacillus sp. OS1-33
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3437217..3446661	3442836..3443222	within	0

Gene organization within MGE regions

Location: 3437217..3446661

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RCG22_RS16655 (RCG22_16655)	-	3437217..3437546 (-)	330	WP_308107187.1	MGMT family protein	-
RCG22_RS16660 (RCG22_16660)	spoIIID	3438205..3438477 (+)	273	WP_026568271.1	sporulation transcriptional regulator SpoIIID	-
RCG22_RS16665 (RCG22_16665)	-	3438673..3439674 (+)	1002	WP_098263835.1	rod shape-determining protein	-
RCG22_RS16670 (RCG22_16670)	-	3440121..3440915 (+)	795	WP_308103830.1	DNA-directed RNA polymerase subunit beta	-
RCG22_RS16675 (RCG22_16675)	fabZ	3441009..3441443 (+)	435	WP_308103831.1	3-hydroxyacyl-ACP dehydratase FabZ	-
RCG22_RS16680 (RCG22_16680)	-	3441596..3441994 (+)	399	WP_308103832.1	hypothetical protein	-
RCG22_RS16685 (RCG22_16685)	-	3442161..3442589 (-)	429	WP_098263839.1	YwpF-like family protein	-
RCG22_RS16690 (RCG22_16690)	ssbB	3442836..3443222 (+)	387	WP_308107188.1	single-stranded DNA-binding protein	Machinery gene
RCG22_RS16695 (RCG22_16695)	-	3443212..3443439 (+)	228	WP_308103833.1	hypothetical protein	-
RCG22_RS16700 (RCG22_16700)	-	3443733..3444146 (-)	414	WP_308103834.1	helix-turn-helix transcriptional regulator	-
RCG22_RS16705 (RCG22_16705)	-	3444367..3444795 (+)	429	WP_308103836.1	hypothetical protein	-
RCG22_RS16710 (RCG22_16710)	-	3445002..3446132 (+)	1131	WP_308103837.1	3D domain-containing protein	-
RCG22_RS16715 (RCG22_16715)	-	3446290..3446661 (-)	372	WP_308103838.1	winged helix-turn-helix transcriptional regulator	-

Sequence

Protein

• Length: 128 a.a.
• Molecular weight: 14407.24 Da
• Isoelectric Point: 7.8821

>NTDB_id=872858 RCG22_RS16690 WP_308107188.1 3442836..3443222(+) (ssbB) [Neobacillus sp. OS1-33]
MINQVTLVGRLTRDPELNKTSEGTPVAHITLAVTRHFRNQNGEIEADFVQCTLWRRAAENTSQYCRKGSVIGITGRLQTR
NYDNKEGKRVYVTEVIAETVRFLSSKPHSETVPAPEPEPKKEEVAIEG

Nucleotide

• Length: 387 bp

>NTDB_id=872858 RCG22_RS16690 WP_308107188.1 3442836..3443222(+) (ssbB) [Neobacillus sp. OS1-33]
ATGATCAATCAAGTCACACTCGTTGGCCGGTTGACGCGAGATCCTGAGCTAAACAAGACATCAGAAGGAACGCCAGTGGC
CCACATCACTTTAGCGGTGACACGACACTTTCGCAATCAAAACGGCGAAATTGAGGCGGATTTCGTTCAGTGTACTCTTT
GGCGGAGGGCGGCGGAAAATACGAGCCAATATTGCCGTAAAGGGTCAGTTATAGGGATTACTGGAAGGTTGCAAACCCGG
AATTACGATAATAAAGAGGGAAAAAGGGTATATGTGACTGAGGTTATCGCCGAAACGGTCCGCTTCCTAAGCTCAAAGCC
ACATAGTGAGACGGTGCCTGCGCCTGAGCCTGAGCCGAAAAAGGAGGAAGTGGCAATTGAGGGATAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Bacillus subtilis subsp. subtilis str. 168	65.421	83.594	0.547
ssbA	Bacillus subtilis subsp. subtilis str. 168	60.377	82.813	0.5
ssb	Latilactobacillus sakei subsp. sakei 23K	52.727	85.938	0.453
ssbB/cilA	Streptococcus pneumoniae TIGR4	47.222	84.375	0.398
ssbB/cilA	Streptococcus pneumoniae Rx1	46.296	84.375	0.391
ssbB/cilA	Streptococcus pneumoniae D39	46.296	84.375	0.391
ssbB/cilA	Streptococcus pneumoniae R6	46.296	84.375	0.391
ssbB/cilA	Streptococcus mitis SK321	46.296	84.375	0.391
ssbB/cilA	Streptococcus mitis NCTC 12261	45.37	84.375	0.383
ssbB	Streptococcus sobrinus strain NIDR 6715-7	44.444	84.375	0.375
ssbA	Streptococcus mutans UA159	44.444	84.375	0.375