NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	RCF72_RS05655	Genome accession	NZ_CP133242
Coordinates	1154842..1155159 (+)	Length	105 a.a.
NCBI ID	WP_037573894.1	Uniprot ID	A0AAE5W8Q2
Organism	Staphylococcus chromogenes strain BTM
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1149842..1160159

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RCF72_RS05625 (RCF72_05595)	-	1150629..1150832 (+)	204	WP_037573910.1	YqgQ family protein	-
RCF72_RS05630 (RCF72_05600)	-	1150829..1151815 (+)	987	WP_419791880.1	ROK family glucokinase	-
RCF72_RS05635 (RCF72_05605)	-	1151816..1152127 (+)	312	WP_037573905.1	MTH1187 family thiamine-binding protein	-
RCF72_RS05640 (RCF72_05610)	-	1152141..1152764 (+)	624	WP_107398561.1	MBL fold metallo-hydrolase	-
RCF72_RS05645 (RCF72_05615)	comGA	1152817..1153791 (+)	975	WP_037573899.1	competence type IV pilus ATPase ComGA	Machinery gene
RCF72_RS05650 (RCF72_05620)	comGB	1153760..1154827 (+)	1068	WP_419791881.1	competence type IV pilus assembly protein ComGB	-
RCF72_RS05655 (RCF72_05625)	comGC	1154842..1155159 (+)	318	WP_037573894.1	competence type IV pilus major pilin ComGC	Machinery gene
RCF72_RS05660 (RCF72_05630)	comGD	1155149..1155580 (+)	432	WP_051604961.1	competence type IV pilus minor pilin ComGD	-
RCF72_RS05665 (RCF72_05635)	-	1155773..1156258 (+)	486	WP_157946193.1	competence type IV pilus minor pilin ComGF	-
RCF72_RS05670 (RCF72_05640)	-	1156423..1156947 (+)	525	WP_103159095.1	shikimate kinase	-
RCF72_RS05675 (RCF72_05645)	gcvT	1157100..1158191 (+)	1092	WP_105965325.1	glycine cleavage system aminomethyltransferase GcvT	-
RCF72_RS05680 (RCF72_05650)	gcvPA	1158204..1159553 (+)	1350	WP_037573882.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11801.05 Da Isoelectric Point: 9.5646

                                >NTDB_id=872720 RCF72_RS05655 WP_037573894.1 1154842..1155159(+) (comGC) [Staphylococcus chromogenes strain BTM]

MKLFKKLKENKGFTLIEMLLVLLIISVLLILIIPNIAKQSEHIQKTGCSAQLKLVESQIEAYTLKFNRKPSTIDELVQEG

YIKENQKSCKNGDTIILRGGEAVVS

Nucleotide

Download Length: 318 bp

                                >NTDB_id=872720 RCF72_RS05655 WP_037573894.1 1154842..1155159(+) (comGC) [Staphylococcus chromogenes strain BTM]

ATGAAATTATTTAAAAAGTTAAAAGAAAACAAGGGGTTTACGTTAATTGAAATGCTTTTAGTTTTGTTAATTATAAGTGT

ACTTTTAATACTAATTATTCCTAATATTGCTAAACAATCAGAACATATTCAAAAAACAGGTTGTTCAGCACAACTTAAAT

TAGTCGAAAGTCAAATTGAAGCATATACTTTGAAATTTAATCGAAAACCTTCAACAATTGACGAACTTGTTCAAGAAGGT

TATATCAAAGAAAATCAAAAATCATGCAAAAATGGAGACACCATCATATTACGTGGCGGAGAAGCCGTTGTTTCATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(10-32)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus N315	66.99	98.095	0.657
comGC	Staphylococcus aureus MW2	66.99	98.095	0.657
comYC	Streptococcus gordonii str. Challis substr. CH1	50	81.905	0.41
comGC	Bacillus subtilis subsp. subtilis str. 168	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	47.674	81.905	0.39
comGC/cglC	Streptococcus pneumoniae TIGR4	47.674	81.905	0.39
comGC/cglC	Streptococcus pneumoniae Rx1	47.674	81.905	0.39
comGC/cglC	Streptococcus pneumoniae D39	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis SK321	49.383	77.143	0.381
comYC	Streptococcus mutans UA140	51.948	73.333	0.381
comYC	Streptococcus mutans UA159	51.948	73.333	0.381
comYC	Streptococcus suis isolate S10	51.316	72.381	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	51.316	72.381	0.371

Detailed information NTG0872720