NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	RA083_RS06305	Genome accession	NZ_CP132557
Coordinates	1278591..1278902 (+)	Length	103 a.a.
NCBI ID	WP_037538386.1	Uniprot ID	A0A380HKV5
Organism	Staphylococcus saprophyticus strain SZ.PL35w
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1273591..1283902

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RA083_RS06275 (RA083_06285)	-	1274329..1274526 (+)	198	WP_041080619.1	YqgQ family protein	-
RA083_RS06280 (RA083_06290)	-	1274530..1275516 (+)	987	WP_069822014.1	glucokinase	-
RA083_RS06285 (RA083_06295)	-	1275516..1275842 (+)	327	WP_002483185.1	MTH1187 family thiamine-binding protein	-
RA083_RS06290 (RA083_06300)	-	1275842..1276465 (+)	624	WP_069822013.1	MBL fold metallo-hydrolase	-
RA083_RS06295 (RA083_06305)	comGA	1276553..1277527 (+)	975	WP_011303021.1	competence type IV pilus ATPase ComGA	Machinery gene
RA083_RS06300 (RA083_06310)	comGB	1277499..1278563 (+)	1065	WP_041080625.1	competence type IV pilus assembly protein ComGB	-
RA083_RS06305 (RA083_06315)	comGC	1278591..1278902 (+)	312	WP_037538386.1	competence type IV pilus major pilin ComGC	Machinery gene
RA083_RS06310 (RA083_06320)	-	1278925..1279338 (+)	414	WP_052463703.1	hypothetical protein	-
RA083_RS06315 (RA083_06325)	comGF	1279596..1280039 (+)	444	WP_069825889.1	competence type IV pilus minor pilin ComGF	-
RA083_RS06320 (RA083_06330)	-	1280243..1280716 (+)	474	WP_002483192.1	shikimate kinase	-
RA083_RS06325 (RA083_06335)	gcvT	1280900..1281991 (+)	1092	WP_041080630.1	glycine cleavage system aminomethyltransferase GcvT	-
RA083_RS06330 (RA083_06340)	gcvPA	1282009..1283361 (+)	1353	WP_011303028.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11386.52 Da Isoelectric Point: 9.5858

                                >NTDB_id=869453 RA083_RS06305 WP_037538386.1 1278591..1278902(+) (comGC) [Staphylococcus saprophyticus strain SZ.PL35w]

MKKLKINRKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHLQNTGCEAQLKMIDSQIEAYALKFNKKPSSIEDLVTEGYI

KENQKSCKSGAAITINNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=869453 RA083_RS06305 WP_037538386.1 1278591..1278902(+) (comGC) [Staphylococcus saprophyticus strain SZ.PL35w]

ATGAAAAAACTAAAAATTAATAGAAAAGCTTTTACATTAATAGAAATGTTACTTGTATTATTGATAATTAGCTTATTATT

AATATTAATTATACCCAATATAGCTAAACAATCGTCTCACTTGCAAAATACTGGATGTGAGGCACAACTTAAAATGATTG

ATAGCCAAATTGAAGCGTATGCTTTAAAGTTTAATAAAAAGCCATCGTCTATAGAAGACTTAGTTACAGAAGGATACATT

AAAGAAAATCAAAAGTCATGTAAATCTGGTGCAGCCATCACTATTAACAATGGTGAAGCTGTTGCAAATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(7-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A380HKV5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	77.895	92.233	0.718
comGC	Staphylococcus aureus N315	77.895	92.233	0.718
comYC	Streptococcus gordonii str. Challis substr. CH1	43.81	100	0.447
comGC/cglC	Streptococcus mitis NCTC 12261	40.777	100	0.408
comYC	Streptococcus mutans UA159	48.837	83.495	0.408
comYC	Streptococcus mutans UA140	48.837	83.495	0.408
comGC	Bacillus subtilis subsp. subtilis str. 168	42.553	91.262	0.388
comGC/cglC	Streptococcus mitis SK321	46.429	81.553	0.379
comYC	Streptococcus suis isolate S10	45.882	82.524	0.379
comGC/cglC	Streptococcus pneumoniae R6	45.238	81.553	0.369
comGC/cglC	Streptococcus pneumoniae D39	45.238	81.553	0.369
comGC/cglC	Streptococcus pneumoniae Rx1	45.238	81.553	0.369
comGC/cglC	Streptococcus pneumoniae TIGR4	45.238	81.553	0.369

Detailed information NTG0869453