Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | Q7638_RS04255 | Genome accession | NZ_CP131663 |
| Coordinates | 881997..882425 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934782.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 2010C06-103 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 872637..915078 | 881997..882425 | within | 0 |
Gene organization within MGE regions
Location: 872637..915078
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7638_RS04170 (Q7638_04160) | sufB | 872637..874034 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| Q7638_RS04175 (Q7638_04165) | - | 874102..875151 (-) | 1050 | WP_001145738.1 | tyrosine-type recombinase/integrase | - |
| Q7638_RS04180 (Q7638_04170) | - | 875264..875443 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| Q7638_RS04185 (Q7638_04175) | - | 875423..876355 (-) | 933 | WP_070031020.1 | hypothetical protein | - |
| Q7638_RS04190 (Q7638_04180) | - | 876387..877112 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| Q7638_RS04195 (Q7638_04185) | - | 877140..877814 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| Q7638_RS04200 (Q7638_04190) | - | 877831..878163 (-) | 333 | WP_001055143.1 | helix-turn-helix transcriptional regulator | - |
| Q7638_RS04205 (Q7638_04195) | - | 878426..878620 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| Q7638_RS04210 (Q7638_04200) | - | 878620..879387 (+) | 768 | WP_341975904.1 | phage antirepressor KilAC domain-containing protein | - |
| Q7638_RS04215 (Q7638_04205) | - | 879388..879612 (+) | 225 | WP_000187184.1 | hypothetical protein | - |
| Q7638_RS04220 (Q7638_04210) | - | 879652..880101 (+) | 450 | WP_001094943.1 | hypothetical protein | - |
| Q7638_RS04225 (Q7638_04215) | - | 880115..880336 (+) | 222 | WP_000977382.1 | hypothetical protein | - |
| Q7638_RS04230 (Q7638_04220) | - | 880329..880490 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| Q7638_RS04235 (Q7638_04225) | - | 880583..880885 (+) | 303 | WP_015984495.1 | DUF2482 family protein | - |
| Q7638_RS04240 (Q7638_04230) | - | 880890..881150 (+) | 261 | WP_155561390.1 | DUF1108 family protein | - |
| Q7638_RS04245 (Q7638_04235) | - | 881160..881381 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| Q7638_RS04250 (Q7638_04240) | - | 881374..881997 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| Q7638_RS04255 (Q7638_04245) | ssbA | 881997..882425 (+) | 429 | WP_000934782.1 | single-stranded DNA-binding protein | Machinery gene |
| Q7638_RS04260 (Q7638_04250) | - | 882439..883107 (+) | 669 | WP_031924605.1 | putative HNHc nuclease | - |
| Q7638_RS04265 (Q7638_04255) | - | 883107..883889 (+) | 783 | WP_000240897.1 | AP2 domain-containing protein | - |
| Q7638_RS04270 (Q7638_04260) | - | 883861..884682 (+) | 822 | WP_052995679.1 | phage replisome organizer N-terminal domain-containing protein | - |
| Q7638_RS04275 (Q7638_04265) | - | 884695..885480 (+) | 786 | WP_031924616.1 | ATP-binding protein | - |
| Q7638_RS04280 (Q7638_04270) | - | 885477..885635 (+) | 159 | WP_000628833.1 | hypothetical protein | - |
| Q7638_RS04285 (Q7638_04275) | - | 885648..885869 (+) | 222 | WP_001123674.1 | DUF3269 family protein | - |
| Q7638_RS04290 (Q7638_04280) | - | 885880..886284 (+) | 405 | WP_000049804.1 | DUF1064 domain-containing protein | - |
| Q7638_RS04295 (Q7638_04285) | - | 886289..886474 (+) | 186 | WP_001187238.1 | DUF3113 family protein | - |
| Q7638_RS04300 (Q7638_04290) | - | 886475..886831 (+) | 357 | WP_341975918.1 | SA1788 family PVL leukocidin-associated protein | - |
| Q7638_RS04305 (Q7638_04295) | - | 886835..887077 (+) | 243 | WP_000131388.1 | phi PVL orf 51-like protein | - |
| Q7638_RS04310 (Q7638_04300) | - | 887092..887340 (+) | 249 | WP_001065093.1 | DUF1024 family protein | - |
| Q7638_RS04315 (Q7638_04305) | - | 887333..887842 (+) | 510 | WP_000185697.1 | dUTPase | - |
| Q7638_RS04320 (Q7638_04310) | - | 887879..888085 (+) | 207 | WP_000195810.1 | DUF1381 domain-containing protein | - |
| Q7638_RS04325 (Q7638_04315) | - | 888082..888468 (+) | 387 | WP_160458169.1 | hypothetical protein | - |
| Q7638_RS04330 (Q7638_04320) | - | 888465..888638 (+) | 174 | WP_000595302.1 | transcriptional activator RinB | - |
| Q7638_RS04335 (Q7638_04325) | - | 888639..889040 (+) | 402 | WP_000286968.1 | hypothetical protein | - |
| Q7638_RS04340 (Q7638_04330) | - | 889395..889889 (+) | 495 | WP_000594088.1 | terminase small subunit | - |
| Q7638_RS04345 (Q7638_04335) | - | 889882..891105 (+) | 1224 | WP_341975926.1 | PBSX family phage terminase large subunit | - |
| Q7638_RS04350 (Q7638_04340) | - | 891102..892526 (+) | 1425 | WP_000177422.1 | phage portal protein | - |
| Q7638_RS04355 (Q7638_04345) | - | 892495..893448 (+) | 954 | WP_000184133.1 | phage head morphogenesis protein | - |
| Q7638_RS04360 (Q7638_04350) | - | 893450..893656 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| Q7638_RS04365 (Q7638_04355) | - | 893759..894343 (+) | 585 | WP_001019220.1 | DUF4355 domain-containing protein | - |
| Q7638_RS04370 (Q7638_04360) | - | 894360..895274 (+) | 915 | WP_000235168.1 | phage major capsid protein | - |
| Q7638_RS04375 (Q7638_04365) | - | 895286..895429 (+) | 144 | WP_000002931.1 | hypothetical protein | - |
| Q7638_RS04380 (Q7638_04370) | - | 895435..895785 (+) | 351 | WP_000177351.1 | phage head-tail adapter protein | - |
| Q7638_RS04385 (Q7638_04375) | - | 895797..896132 (+) | 336 | WP_000483041.1 | phage head closure protein | - |
| Q7638_RS04390 (Q7638_04380) | - | 896119..896526 (+) | 408 | WP_031836888.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| Q7638_RS04395 (Q7638_04385) | - | 896539..896964 (+) | 426 | WP_000270189.1 | DUF3168 domain-containing protein | - |
| Q7638_RS04400 (Q7638_04390) | - | 896965..897522 (+) | 558 | WP_000057582.1 | tail protein | - |
| Q7638_RS04405 (Q7638_04395) | - | 897588..898094 (+) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| Q7638_RS04410 (Q7638_04400) | - | 898139..898423 (+) | 285 | WP_000880588.1 | hypothetical protein | - |
| Q7638_RS04415 (Q7638_04405) | - | 898427..901312 (+) | 2886 | WP_000379450.1 | terminase | - |
| Q7638_RS04420 (Q7638_04410) | - | 901327..902268 (+) | 942 | WP_000560187.1 | phage tail domain-containing protein | - |
| Q7638_RS04425 (Q7638_04415) | - | 902279..904165 (+) | 1887 | WP_001121997.1 | phage tail protein | - |
| Q7638_RS04430 (Q7638_04420) | - | 904178..906076 (+) | 1899 | WP_000323265.1 | hypothetical protein | - |
| Q7638_RS04435 (Q7638_04425) | - | 906076..907899 (+) | 1824 | WP_000259612.1 | BppU family phage baseplate upper protein | - |
| Q7638_RS04440 (Q7638_04430) | - | 907899..908276 (+) | 378 | WP_000705914.1 | DUF2977 domain-containing protein | - |
| Q7638_RS04445 (Q7638_04435) | - | 908286..908459 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| Q7638_RS04450 (Q7638_04440) | - | 908500..908799 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| Q7638_RS04455 (Q7638_04445) | - | 908936..910810 (+) | 1875 | WP_341975943.1 | glucosaminidase domain-containing protein | - |
| Q7638_RS04460 (Q7638_04450) | - | 910823..911995 (+) | 1173 | WP_160458226.1 | BppU family phage baseplate upper protein | - |
| Q7638_RS04465 (Q7638_04455) | - | 912001..912396 (+) | 396 | WP_000398861.1 | hypothetical protein | - |
| Q7638_RS04470 (Q7638_04460) | - | 912452..912889 (+) | 438 | WP_000354119.1 | phage holin | - |
| Q7638_RS04475 (Q7638_04465) | - | 912870..914315 (+) | 1446 | WP_072489981.1 | SH3 domain-containing protein | - |
| Q7638_RS04480 (Q7638_04470) | - | 914558..914710 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| Q7638_RS04485 (Q7638_04475) | - | 914781..914891 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| Q7638_RS04490 (Q7638_04480) | - | 914893..915078 (+) | 186 | WP_053868874.1 | XRE family transcriptional regulator | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15980.48 Da Isoelectric Point: 5.8724
>NTDB_id=863468 Q7638_RS04255 WP_000934782.1 881997..882425(+) (ssbA) [Staphylococcus aureus strain 2010C06-103]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVAADSVQFLEPKNSNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVAADSVQFLEPKNSNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=863468 Q7638_RS04255 WP_000934782.1 881997..882425(+) (ssbA) [Staphylococcus aureus strain 2010C06-103]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGCAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGCAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.599 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.401 |