Detailed information NTG0859878

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: Q3V78_RS08190
• Genome accession: NZ_CP130538
• Coordinates: 1656618..1656929 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain SA11-SX
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1651618..1661929

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
Q3V78_RS08155	gcvPA	1652120..1653466 (-)	1347	WP_226452143.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
Q3V78_RS08160	gcvT	1653486..1654577 (-)	1092	WP_226452142.1	glycine cleavage system aminomethyltransferase GcvT	-
Q3V78_RS08165	-	1654736..1655260 (-)	525	WP_001015120.1	shikimate kinase	-
Q3V78_RS08170	-	1655250..1655396 (-)	147	WP_001789879.1	hypothetical protein	-
Q3V78_RS08175	comGF	1655493..1655990 (-)	498	WP_001825340.1	competence type IV pilus minor pilin ComGF	Machinery gene
Q3V78_RS08180	comGE	1655908..1656207 (-)	300	WP_000844415.1	hypothetical protein	Machinery gene
Q3V78_RS08185	comGD	1656194..1656640 (-)	447	WP_072357807.1	competence type IV pilus minor pilin ComGD	Machinery gene
Q3V78_RS08190	comGC	1656618..1656929 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
Q3V78_RS08195	comGB	1656943..1658013 (-)	1071	WP_000776413.1	competence type IV pilus assembly protein ComGB	Machinery gene
Q3V78_RS08200	comGA	1657985..1658959 (-)	975	WP_000697222.1	competence type IV pilus ATPase ComGA	Machinery gene
Q3V78_RS08205	-	1659011..1659634 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
Q3V78_RS08210	-	1659631..1659960 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
Q3V78_RS08215	-	1659960..1660946 (-)	987	WP_000161315.1	ROK family glucokinase	-
Q3V78_RS08220	-	1660943..1661146 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=859878 Q3V78_RS08190 WP_000472256.1 1656618..1656929(-) (comGC) [Staphylococcus aureus strain SA11-SX]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=859878 Q3V78_RS08190 WP_000472256.1 1656618..1656929(-) (comGC) [Staphylococcus aureus strain SA11-SX]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369