Detailed information NTG0084034

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: SA231_RS11860
• Genome accession: NZ_AP024203
• Coordinates: 2394712..2395023 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472255.1
• Uniprot ID: A0A0U1MLR1
• Organism: Staphylococcus aureus strain SA23-1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2389712..2400023

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SA231_RS11825 (SA231_22930)	gcvPA	2390214..2391560 (-)	1347	WP_117219988.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
SA231_RS11830 (SA231_22940)	gcvT	2391580..2392671 (-)	1092	WP_000093344.1	glycine cleavage system aminomethyltransferase GcvT	-
SA231_RS11835 (SA231_22950)	-	2392830..2393354 (-)	525	WP_033858309.1	shikimate kinase	-
SA231_RS11840	-	2393344..2393490 (-)	147	WP_001789879.1	hypothetical protein	-
SA231_RS11845 (SA231_22960)	comGF	2393587..2394084 (-)	498	WP_117219987.1	competence type IV pilus minor pilin ComGF	Machinery gene
SA231_RS11850 (SA231_22970)	comGE	2394002..2394301 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
SA231_RS11855 (SA231_22980)	comGD	2394288..2394734 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
SA231_RS11860 (SA231_22990)	comGC	2394712..2395023 (-)	312	WP_000472255.1	competence type IV pilus major pilin ComGC	Machinery gene
SA231_RS11865 (SA231_23000)	comGB	2395037..2396107 (-)	1071	WP_000776409.1	competence type IV pilus assembly protein ComGB	Machinery gene
SA231_RS11870 (SA231_23010)	comGA	2396079..2397053 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
SA231_RS11875 (SA231_23020)	-	2397105..2397728 (-)	624	WP_001223009.1	MBL fold metallo-hydrolase	-
SA231_RS11880 (SA231_23030)	-	2397725..2398054 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
SA231_RS11885 (SA231_23040)	-	2398054..2399040 (-)	987	WP_000161307.1	ROK family glucokinase	-
SA231_RS11890 (SA231_23050)	-	2399037..2399240 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11301.33 Da
• Isoelectric Point: 8.5268

>NTDB_id=84034 SA231_RS11860 WP_000472255.1 2394712..2395023(-) (comGC) [Staphylococcus aureus strain SA23-1]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGESITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=84034 SA231_RS11860 WP_000472255.1 2394712..2395023(-) (comGC) [Staphylococcus aureus strain SA23-1]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGTCAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A0U1MLR1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369