Detailed information
Bioinformatically predicted
Overview
| Name | ssbB | Type | Machinery gene |
| Locus tag | QNH39_RS26695 | Genome accession | NZ_CP126114 |
| Coordinates | 5401854..5402222 (-) | Length | 122 a.a. |
| NCBI ID | WP_066093723.1 | Uniprot ID | A0AA95MM95 |
| Organism | Neobacillus novalis strain XLM17 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 5389084..5409138 | 5401854..5402222 | within | 0 |
Gene organization within MGE regions
Location: 5389084..5409138
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH39_RS26640 (QNH39_26640) | - | 5389084..5392203 (+) | 3120 | WP_066093687.1 | DEAD/DEAH box helicase | - |
| QNH39_RS26645 (QNH39_26645) | - | 5392474..5393592 (-) | 1119 | WP_342342339.1 | 3D domain-containing protein | - |
| QNH39_RS26650 (QNH39_26650) | - | 5393803..5394657 (-) | 855 | WP_066093694.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| QNH39_RS26655 (QNH39_26655) | - | 5394700..5395110 (-) | 411 | WP_066093697.1 | hypothetical protein | - |
| QNH39_RS26660 (QNH39_26660) | - | 5395371..5395847 (+) | 477 | WP_066148055.1 | helix-turn-helix transcriptional regulator | - |
| QNH39_RS26665 (QNH39_26665) | - | 5396170..5396913 (+) | 744 | WP_235845689.1 | transporter substrate-binding domain-containing protein | - |
| QNH39_RS26670 (QNH39_26670) | - | 5397097..5397744 (+) | 648 | WP_066093707.1 | amino acid ABC transporter permease | - |
| QNH39_RS26675 (QNH39_26675) | - | 5397784..5398521 (+) | 738 | WP_066093710.1 | amino acid ABC transporter ATP-binding protein | - |
| QNH39_RS26680 (QNH39_26680) | - | 5398921..5399790 (-) | 870 | WP_066093713.1 | RNA polymerase sigma-70 factor | - |
| QNH39_RS26685 (QNH39_26685) | - | 5399796..5401094 (-) | 1299 | WP_066093716.1 | FAD-dependent oxidoreductase | - |
| QNH39_RS26690 (QNH39_26690) | - | 5401442..5401810 (+) | 369 | WP_066093719.1 | hypothetical protein | - |
| QNH39_RS26695 (QNH39_26695) | ssbB | 5401854..5402222 (-) | 369 | WP_066093723.1 | single-stranded DNA-binding protein | Machinery gene |
| QNH39_RS26700 (QNH39_26700) | - | 5402469..5402900 (+) | 432 | WP_066097107.1 | YwpF-like family protein | - |
| QNH39_RS26705 (QNH39_26705) | fabZ | 5402979..5403413 (-) | 435 | WP_066093726.1 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
| QNH39_RS26710 (QNH39_26710) | - | 5403604..5403924 (-) | 321 | WP_066093729.1 | DNA-directed RNA polymerase subunit beta | - |
| QNH39_RS26715 (QNH39_26715) | - | 5404299..5405300 (-) | 1002 | WP_066093732.1 | rod shape-determining protein | - |
| QNH39_RS26720 (QNH39_26720) | spoIIID | 5405569..5405841 (-) | 273 | WP_040207082.1 | sporulation transcriptional regulator SpoIIID | - |
| QNH39_RS26725 (QNH39_26725) | - | 5406610..5406924 (+) | 315 | WP_066093735.1 | MGMT family protein | - |
| QNH39_RS26730 (QNH39_26730) | - | 5407111..5409138 (-) | 2028 | WP_066093738.1 | penicillin-binding transpeptidase domain-containing protein | - |
Sequence
Protein
Download Length: 122 a.a. Molecular weight: 13702.47 Da Isoelectric Point: 9.5175
>NTDB_id=836614 QNH39_RS26695 WP_066093723.1 5401854..5402222(-) (ssbB) [Neobacillus novalis strain XLM17]
MINQVTLVGRLARDPDLKTTTEGTSVAHITLAVNRHYRNHNGEIEADFVQCTLWRKAAENTNQYCRKGSIVGITGRLQTR
NYENKEGKRVYVTEVIAETIRFLGAKPAATGSEQKREEVQIG
MINQVTLVGRLARDPDLKTTTEGTSVAHITLAVNRHYRNHNGEIEADFVQCTLWRKAAENTNQYCRKGSIVGITGRLQTR
NYENKEGKRVYVTEVIAETIRFLGAKPAATGSEQKREEVQIG
Nucleotide
Download Length: 369 bp
>NTDB_id=836614 QNH39_RS26695 WP_066093723.1 5401854..5402222(-) (ssbB) [Neobacillus novalis strain XLM17]
ATGATTAATCAGGTCACACTTGTCGGTCGATTGGCCAGGGACCCGGATTTAAAAACGACGACAGAAGGGACGTCGGTTGC
CCACATAACGCTAGCGGTTAATCGCCACTACCGGAACCACAATGGTGAGATTGAAGCCGATTTTGTTCAGTGCACACTTT
GGCGCAAGGCCGCCGAAAACACGAACCAATATTGCCGTAAGGGTTCCATCGTTGGGATCACAGGCAGATTGCAAACCCGG
AATTATGAGAATAAAGAGGGCAAAAGGGTGTACGTCACCGAGGTGATCGCCGAAACAATCCGCTTCTTAGGAGCCAAGCC
GGCTGCAACGGGCAGCGAGCAAAAAAGGGAGGAAGTACAGATTGGTTAA
ATGATTAATCAGGTCACACTTGTCGGTCGATTGGCCAGGGACCCGGATTTAAAAACGACGACAGAAGGGACGTCGGTTGC
CCACATAACGCTAGCGGTTAATCGCCACTACCGGAACCACAATGGTGAGATTGAAGCCGATTTTGTTCAGTGCACACTTT
GGCGCAAGGCCGCCGAAAACACGAACCAATATTGCCGTAAGGGTTCCATCGTTGGGATCACAGGCAGATTGCAAACCCGG
AATTATGAGAATAAAGAGGGCAAAAGGGTGTACGTCACCGAGGTGATCGCCGAAACAATCCGCTTCTTAGGAGCCAAGCC
GGCTGCAACGGGCAGCGAGCAAAAAAGGGAGGAAGTACAGATTGGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
66.355 |
87.705 |
0.582 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.586 |
95.082 |
0.5 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
86.885 |
0.492 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.283 |
86.885 |
0.393 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.283 |
86.885 |
0.393 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.34 |
86.885 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.34 |
86.885 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.34 |
86.885 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.34 |
86.885 |
0.385 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.34 |
86.885 |
0.385 |
| ssbA | Streptococcus mutans UA159 |
41.509 |
86.885 |
0.361 |