Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QM338_RS05265 | Genome accession | NZ_CP125901 |
| Coordinates | 1074436..1074864 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934783.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain CHAL2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1066703..1109870 | 1074436..1074864 | within | 0 |
Gene organization within MGE regions
Location: 1066703..1109870
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM338_RS05190 (QM338_05190) | - | 1066703..1068088 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| QM338_RS05195 (QM338_05195) | - | 1068295..1068975 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| QM338_RS05200 (QM338_05200) | - | 1069159..1069617 (-) | 459 | WP_024937215.1 | hypothetical protein | - |
| QM338_RS05205 (QM338_05205) | - | 1069639..1069965 (-) | 327 | WP_000455972.1 | helix-turn-helix transcriptional regulator | - |
| QM338_RS05210 (QM338_05210) | - | 1070128..1070337 (+) | 210 | WP_001113664.1 | helix-turn-helix transcriptional regulator | - |
| QM338_RS05215 (QM338_05215) | - | 1070377..1071258 (+) | 882 | WP_024937216.1 | ParB N-terminal domain-containing protein | - |
| QM338_RS05220 (QM338_05220) | - | 1071251..1072018 (+) | 768 | WP_000282677.1 | DUF6551 family protein | - |
| QM338_RS05225 (QM338_05225) | - | 1072089..1072259 (+) | 171 | WP_000398751.1 | hypothetical protein | - |
| QM338_RS05230 (QM338_05230) | - | 1072248..1072457 (-) | 210 | WP_000033736.1 | hypothetical protein | - |
| QM338_RS05235 (QM338_05235) | - | 1072664..1072894 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| QM338_RS05240 (QM338_05240) | - | 1072944..1073081 (+) | 138 | WP_000230552.1 | hypothetical protein | - |
| QM338_RS05245 (QM338_05245) | - | 1073074..1073235 (+) | 162 | WP_000066027.1 | DUF1270 family protein | - |
| QM338_RS05250 (QM338_05250) | - | 1073329..1073589 (+) | 261 | WP_000291076.1 | DUF1108 family protein | - |
| QM338_RS05255 (QM338_05255) | - | 1073599..1073820 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| QM338_RS05260 (QM338_05260) | - | 1073813..1074436 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| QM338_RS05265 (QM338_05265) | ssbA | 1074436..1074864 (+) | 429 | WP_000934783.1 | single-stranded DNA-binding protein | Machinery gene |
| QM338_RS05270 (QM338_05270) | - | 1074878..1075552 (+) | 675 | WP_015977703.1 | putative HNHc nuclease | - |
| QM338_RS05275 (QM338_05275) | - | 1075658..1076515 (-) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| QM338_RS05280 (QM338_05280) | - | 1076580..1077358 (+) | 779 | Protein_1030 | conserved phage C-terminal domain-containing protein | - |
| QM338_RS05285 (QM338_05285) | - | 1077368..1078147 (+) | 780 | WP_000803065.1 | ATP-binding protein | - |
| QM338_RS05290 (QM338_05290) | - | 1078141..1078302 (+) | 162 | WP_000237153.1 | hypothetical protein | - |
| QM338_RS05295 (QM338_05295) | - | 1078315..1078536 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| QM338_RS05300 (QM338_05300) | - | 1078546..1078950 (+) | 405 | WP_000049798.1 | DUF1064 domain-containing protein | - |
| QM338_RS05305 (QM338_05305) | - | 1078955..1079140 (+) | 186 | WP_283512332.1 | DUF3113 family protein | - |
| QM338_RS05310 (QM338_05310) | - | 1079141..1079500 (+) | 360 | WP_000029381.1 | SA1788 family PVL leukocidin-associated protein | - |
| QM338_RS05315 (QM338_05315) | - | 1079501..1079749 (+) | 249 | WP_061389595.1 | phi PVL orf 51-like protein | - |
| QM338_RS05320 (QM338_05320) | - | 1079763..1080005 (+) | 243 | WP_001065066.1 | DUF1024 family protein | - |
| QM338_RS05325 (QM338_05325) | - | 1080005..1080211 (+) | 207 | WP_283512333.1 | Lar family restriction alleviation protein | - |
| QM338_RS05330 (QM338_05330) | - | 1080204..1080734 (+) | 531 | WP_000185706.1 | dUTPase | - |
| QM338_RS05335 (QM338_05335) | - | 1080771..1081058 (+) | 288 | WP_001613442.1 | DUF1381 domain-containing protein | - |
| QM338_RS05340 (QM338_05340) | - | 1081051..1081287 (+) | 237 | WP_000608276.1 | hypothetical protein | - |
| QM338_RS05345 (QM338_05345) | - | 1081277..1081663 (+) | 387 | WP_283512334.1 | hypothetical protein | - |
| QM338_RS05350 (QM338_05350) | - | 1081663..1081836 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| QM338_RS05355 (QM338_05355) | - | 1081837..1081983 (+) | 147 | WP_000989998.1 | hypothetical protein | - |
| QM338_RS05360 (QM338_05360) | - | 1082007..1082429 (+) | 423 | WP_000162699.1 | RinA family phage transcriptional activator | - |
| QM338_RS05365 (QM338_05365) | - | 1082616..1083056 (+) | 441 | WP_001003271.1 | terminase small subunit | - |
| QM338_RS05370 (QM338_05370) | - | 1083043..1084320 (+) | 1278 | WP_183137407.1 | PBSX family phage terminase large subunit | - |
| QM338_RS05375 (QM338_05375) | - | 1084331..1085869 (+) | 1539 | WP_000921889.1 | phage portal protein | - |
| QM338_RS05380 (QM338_05380) | - | 1085876..1086871 (+) | 996 | WP_283512335.1 | minor capsid protein | - |
| QM338_RS05385 (QM338_05385) | - | 1086944..1087114 (+) | 171 | WP_000072207.1 | hypothetical protein | - |
| QM338_RS05390 (QM338_05390) | - | 1087249..1087863 (+) | 615 | WP_000354309.1 | DUF4355 domain-containing protein | - |
| QM338_RS05395 (QM338_05395) | - | 1087877..1088851 (+) | 975 | WP_000438512.1 | phage major capsid protein | - |
| QM338_RS05400 (QM338_05400) | - | 1088873..1089160 (+) | 288 | WP_001114085.1 | hypothetical protein | - |
| QM338_RS05405 (QM338_05405) | - | 1089169..1089501 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| QM338_RS05410 (QM338_05410) | - | 1089498..1089800 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| QM338_RS05415 (QM338_05415) | - | 1089800..1090147 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QM338_RS05420 (QM338_05420) | - | 1090159..1090542 (+) | 384 | WP_000188640.1 | hypothetical protein | - |
| QM338_RS05425 (QM338_05425) | - | 1090561..1091142 (+) | 582 | WP_000002578.1 | phage major tail protein, TP901-1 family | - |
| QM338_RS05430 (QM338_05430) | - | 1091205..1091570 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| QM338_RS05435 (QM338_05435) | - | 1091600..1091944 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| QM338_RS05440 (QM338_05440) | - | 1091961..1095425 (+) | 3465 | WP_283512336.1 | hypothetical protein | - |
| QM338_RS05445 (QM338_05445) | - | 1095438..1096385 (+) | 948 | WP_094637845.1 | phage tail family protein | - |
| QM338_RS05450 (QM338_05450) | - | 1096394..1098292 (+) | 1899 | WP_176429809.1 | SGNH/GDSL hydrolase family protein | - |
| QM338_RS05455 (QM338_05455) | - | 1098307..1100217 (+) | 1911 | WP_283512337.1 | hypothetical protein | - |
| QM338_RS05460 (QM338_05460) | - | 1100217..1102040 (+) | 1824 | WP_223081630.1 | BppU family phage baseplate upper protein | - |
| QM338_RS05465 (QM338_05465) | - | 1102040..1102417 (+) | 378 | WP_000705896.1 | DUF2977 domain-containing protein | - |
| QM338_RS05470 (QM338_05470) | - | 1102421..1102594 (+) | 174 | WP_000782200.1 | XkdX family protein | - |
| QM338_RS05475 (QM338_05475) | - | 1102634..1102933 (+) | 300 | WP_000466778.1 | DUF2951 domain-containing protein | - |
| QM338_RS05480 (QM338_05480) | - | 1103070..1104968 (+) | 1899 | WP_244757391.1 | glucosaminidase domain-containing protein | - |
| QM338_RS05485 (QM338_05485) | - | 1104981..1106219 (+) | 1239 | WP_244757390.1 | BppU family phage baseplate upper protein | - |
| QM338_RS05490 (QM338_05490) | - | 1106224..1106619 (+) | 396 | WP_015978335.1 | hypothetical protein | - |
| QM338_RS05495 (QM338_05495) | - | 1106675..1107112 (+) | 438 | WP_038805694.1 | phage holin | - |
| QM338_RS05500 (QM338_05500) | - | 1107093..1108538 (+) | 1446 | WP_031790419.1 | SH3 domain-containing protein | - |
| QM338_RS05505 (QM338_05505) | - | 1108928..1109278 (+) | 351 | WP_000448198.1 | hypothetical protein | - |
| QM338_RS05510 (QM338_05510) | - | 1109326..1109514 (+) | 189 | WP_000626839.1 | hypothetical protein | - |
| QM338_RS05515 (QM338_05515) | - | 1109511..1109870 (+) | 360 | WP_283512338.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16047.61 Da Isoelectric Point: 5.8724
>NTDB_id=833549 QM338_RS05265 WP_000934783.1 1074436..1074864(+) (ssbA) [Staphylococcus aureus strain CHAL2]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=833549 QM338_RS05265 WP_000934783.1 1074436..1074864(+) (ssbA) [Staphylococcus aureus strain CHAL2]
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
46.957 |
80.986 |
0.38 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.099 |
0.373 |