Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | R8615_RS09690 | Genome accession | NZ_AP026929 |
| Coordinates | 1877397..1877723 (-) | Length | 108 a.a. |
| NCBI ID | WP_000738625.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain PZ900701114 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1872397..1882723
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8615_RS09645 (PC1101_18860) | rnpA | 1872422..1872793 (-) | 372 | WP_000739247.1 | ribonuclease P protein component | - |
| R8615_RS09650 | - | 1872810..1872941 (-) | 132 | WP_000768904.1 | hypothetical protein | - |
| R8615_RS09655 (PC1101_18870) | - | 1872942..1874132 (-) | 1191 | WP_000167765.1 | acetate kinase | - |
| R8615_RS09660 (PC1101_18880) | comGH | 1874183..1875136 (-) | 954 | WP_000345122.1 | class I SAM-dependent methyltransferase | Machinery gene |
| R8615_RS09665 (PC1101_18890) | - | 1875197..1875784 (-) | 588 | WP_000679779.1 | class I SAM-dependent methyltransferase | - |
| R8615_RS09670 (PC1101_18900) | comGG/cglG | 1875887..1876333 (-) | 447 | WP_001811371.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| R8615_RS09675 (PC1101_18910) | comGF/cglF | 1876311..1876772 (-) | 462 | WP_000250539.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| R8615_RS09680 (PC1101_18920) | comGE/cglE | 1876735..1877037 (-) | 303 | WP_000413382.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| R8615_RS09685 (PC1101_18930) | comGD/cglD | 1877000..1877404 (-) | 405 | WP_000588030.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| R8615_RS09690 (PC1101_18940) | comGC/cglC | 1877397..1877723 (-) | 327 | WP_000738625.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| R8615_RS09695 (PC1101_18950) | comGB/cglB | 1877725..1878741 (-) | 1017 | WP_074017570.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| R8615_RS09700 (PC1101_18960) | comGA/cglA/cilD | 1878689..1879630 (-) | 942 | WP_000249555.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| R8615_RS09705 (PC1101_18970) | - | 1879705..1880070 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| R8615_RS09710 (PC1101_18980) | - | 1880217..1881275 (-) | 1059 | WP_000649471.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| R8615_RS09715 (PC1101_18990) | nagA | 1881438..1882589 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
Sequence
Protein
Download Length: 108 a.a. Molecular weight: 12143.28 Da Isoelectric Point: 10.0055
>NTDB_id=83218 R8615_RS09690 WP_000738625.1 1877397..1877723(-) (comGC/cglC) [Streptococcus pneumoniae strain PZ900701114]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLDKNEDATLSKLQG
DGRITEEQVKAYNEYYTKNGGANRKVND
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLDKNEDATLSKLQG
DGRITEEQVKAYNEYYTKNGGANRKVND
Nucleotide
Download Length: 327 bp
>NTDB_id=83218 R8615_RS09690 WP_000738625.1 1877397..1877723(-) (comGC/cglC) [Streptococcus pneumoniae strain PZ900701114]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAGATGTTAGTAGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGATAAAAATGAAGATGCTACTCTGAGCAAGTTACAAGGA
GATGGGCGCATCACGGAAGAACAGGTTAAAGCTTATAATGAATACTATACTAAAAATGGAGGGGCAAATCGTAAAGTCAA
TGATTAA
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAGATGTTAGTAGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGATAAAAATGAAGATGCTACTCTGAGCAAGTTACAAGGA
GATGGGCGCATCACGGAAGAACAGGTTAAAGCTTATAATGAATACTATACTAAAAATGGAGGGGCAAATCGTAAAGTCAA
TGATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus mitis SK321 |
95.37 |
100 |
0.954 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
92.593 |
100 |
0.926 |
| comGC/cglC | Streptococcus pneumoniae D39 |
92.593 |
100 |
0.926 |
| comGC/cglC | Streptococcus pneumoniae R6 |
92.593 |
100 |
0.926 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
92.593 |
100 |
0.926 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
92.857 |
90.741 |
0.843 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
67.961 |
95.37 |
0.648 |
| comGC | Streptococcus mutans UA140 |
62.745 |
94.444 |
0.593 |
| comGC | Streptococcus mutans UA159 |
62.745 |
94.444 |
0.593 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
56.863 |
94.444 |
0.537 |
| comGC | Streptococcus suis isolate S10 |
64.773 |
81.481 |
0.528 |
| comGC | Staphylococcus aureus MW2 |
47.674 |
79.63 |
0.38 |
| comGC | Staphylococcus aureus N315 |
47.674 |
79.63 |
0.38 |