NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	QFX46_RS06515	Genome accession	NZ_CP123739
Coordinates	1225871..1226182 (+)	Length	103 a.a.
NCBI ID	WP_000472256.1	Uniprot ID	-
Organism	Staphylococcus aureus strain 2.5
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1220871..1231182

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QFX46_RS06485	-	1221654..1221857 (+)	204	WP_000087561.1	YqgQ family protein	-
QFX46_RS06490	-	1221854..1222840 (+)	987	WP_000161314.1	ROK family glucokinase	-
QFX46_RS06495	-	1222840..1223169 (+)	330	WP_304984508.1	MTH1187 family thiamine-binding protein	-
QFX46_RS06500	-	1223166..1223789 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
QFX46_RS06505	comGA	1223841..1224815 (+)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
QFX46_RS06510	comGB	1224787..1225857 (+)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
QFX46_RS06515	comGC	1225871..1226182 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
QFX46_RS06520	comGD	1226160..1226606 (+)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
QFX46_RS06525	comGE	1226593..1226892 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
QFX46_RS06530	comGF	1226810..1227307 (+)	498	WP_029642894.1	competence type IV pilus minor pilin ComGF	Machinery gene
QFX46_RS06535	-	1227404..1227550 (+)	147	WP_001789879.1	hypothetical protein	-
QFX46_RS06540	-	1227540..1228064 (+)	525	WP_001015119.1	shikimate kinase	-
QFX46_RS06545	gcvT	1228223..1229314 (+)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
QFX46_RS06550	gcvPA	1229334..1230680 (+)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268

                                >NTDB_id=822017 QFX46_RS06515 WP_000472256.1 1225871..1226182(+) (comGC) [Staphylococcus aureus strain 2.5]

MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI

KEAQKTCKSGETITISNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=822017 QFX46_RS06515 WP_000472256.1 1225871..1226182(+) (comGC) [Staphylococcus aureus strain 2.5]

ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT

AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA

ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA

AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369

Detailed information NTG0822017