NTDB

Overview

Name	ssbB/cilA	Type	Machinery gene
Locus tag	R4702_RS07330	Genome accession	NZ_CP137106
Coordinates	1422054..1422449 (+)	Length	131 a.a.
NCBI ID	WP_000282467.1	Uniprot ID	Q8DNH4
Organism	Streptococcus pneumoniae strain 16P4028
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 1417054..1427449

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R4702_RS07280	-	1417179..1417541 (+)	363	WP_000078805.1	DUF2200 domain-containing protein	-
R4702_RS07285	-	1417538..1418041 (+)	504	WP_044789202.1	phosphatase PAP2 family protein	-
R4702_RS07290	-	1418155..1418601 (+)	447	WP_000776589.1	LytTR family DNA-binding domain-containing protein	-
R4702_RS07295	-	1418607..1419281 (+)	675	WP_050148694.1	LiaF transmembrane domain-containing protein	-
R4702_RS07300	-	1419442..1419633 (+)	192	WP_000291826.1	cell wall-binding protein	-
R4702_RS07305	-	1419658..1419720 (+)	63	WP_219300018.1	hypothetical protein	-
R4702_RS07310	-	1419918..1420217 (+)	300	WP_001013974.1	DUF4651 domain-containing protein	-
R4702_RS07315	-	1420214..1420531 (+)	318	WP_000615772.1	thioredoxin family protein	-
R4702_RS07320	ytpR	1420547..1421173 (+)	627	WP_000578289.1	YtpR family tRNA-binding protein	-
R4702_RS07325	-	1421215..1421976 (+)	762	WP_001107757.1	SDR family oxidoreductase	-
R4702_RS07330	ssbB/cilA	1422054..1422449 (+)	396	WP_000282467.1	single-stranded DNA-binding protein	Machinery gene
R4702_RS07335	groES	1422719..1423003 (+)	285	WP_000917339.1	co-chaperone GroES	-
R4702_RS07340	groL	1423019..1424641 (+)	1623	WP_000031573.1	chaperonin GroEL	-
R4702_RS07345	-	1424779..1425534 (+)	756	Protein_1429	epoxyqueuosine reductase QueH	-
R4702_RS07350	-	1425980..1426753 (+)	774	WP_050091347.1	class I SAM-dependent methyltransferase	-
R4702_RS07355	-	1426766..1427098 (+)	333	WP_033705125.1	helix-turn-helix transcriptional regulator	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14925.89 Da Isoelectric Point: 5.9409

                                >NTDB_id=819186 R4702_RS07330 WP_000282467.1 1422054..1422449(+) (ssbB/cilA) [Streptococcus pneumoniae strain 16P4028]

MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR

RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=819186 R4702_RS07330 WP_000282467.1 1422054..1422449(+) (ssbB/cilA) [Streptococcus pneumoniae strain 16P4028]

ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC

GCGAGCAACTATCGCTGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTCAATATGGTCCTAT

GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT

CGCTTTGAGAAAAATGGCCAAATGAACTACGTGACCGAAGTACTTGTAACAGGATTCCAACTCTTGGAAAGTCGTGCTCA

ACGTGCCATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTAGTCTTGGAAGAGGAAGAATTGCCATTTTAA

Domains

Predicted by InterProScan.

Single-strand binding protein family (SSB)

(3-101)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	Q8DNH4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB/cilA	Streptococcus pneumoniae D39	100	100	1
ssbB/cilA	Streptococcus pneumoniae Rx1	100	100	1
ssbB/cilA	Streptococcus pneumoniae R6	100	100	1
ssbB/cilA	Streptococcus pneumoniae TIGR4	99.237	100	0.992
ssbB/cilA	Streptococcus mitis SK321	98.473	100	0.985
ssbB/cilA	Streptococcus mitis NCTC 12261	98.473	100	0.985
ssbA	Streptococcus mutans UA159	74.809	100	0.748
ssbB	Streptococcus sobrinus strain NIDR 6715-7	70.229	100	0.702
ssbB	Lactococcus lactis subsp. cremoris KW2	59.821	85.496	0.511
ssbA	Bacillus subtilis subsp. subtilis str. 168	50.943	80.916	0.412
ssb	Latilactobacillus sakei subsp. sakei 23K	46.903	86.26	0.405

Detailed information NTG0819186